DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fa2h and ch25hl3

Sequence 1:NP_610279.3 Gene:fa2h FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_001344424.1 Gene:ch25hl3 ZFINID:ZDB-GENE-180119-1 Length:267 Species:Danio rerio

Alignment Length:244 Identity:51/245 (21%)
Similarity:78/245 (32%) Gaps:88/245 (36%)


  Fly   140 WVHK-PVDRPLRLFDPWYLEMCTKTPWW-----LVPL---------FWIPVIVKCAVEEFTTAWQ 189
            |:|| .:.|.|...:.|:  .|.....|     ::||         ..:|......::.|...  
Zfish    63 WIHKYRIRRQLVGLNEWF--RCASRILWKYVVGVLPLTALLLSLRRTHLPEKAPSMLQSFREC-- 123

  Fly   190 DSNQLAVFSGYFLFGVLLWSFLEYTLHR--WVFHVKLSNKSGSWLCTFHFMIHGLHHKVPFDPMR 252
                   .|...:|..|.:.| .||:|:  |.:|                .||..||.     .|
Zfish   124 -------ISCMLVFDTLFFMF-HYTIHKIPWFYH----------------NIHSAHHM-----NR 159

  Fly   253 LVFPPLPG-------------AVLAAVIYT--PLSFVLSHPRVILSG--ALAGYLCYDMMHYYLH 300
            ..|.....             |.|:|::..  |||.:|.|   :|:.  |:..:..|| ..:.||
Zfish   160 ETFALAAQDSSIGELLSLQSLAFLSAMLVRCHPLSEILFH---LLNTWMAVEDHCGYD-FPWALH 220

  Fly   301 YGNPSLWAFVHMKRYHHHH------HFSHQTLGYGISSPLWDVVFKTRI 343
            ...|......|...:|.|.      :|.|           ||.:|.|.:
Zfish   221 RLLPCFSGAPHHSAHHQHFRGNFAPYFRH-----------WDYIFGTSL 258

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597
FA_hydroxylase 117..341 CDD:294712 50/241 (21%)
ch25hl3XP_001344424.1 FA_hydroxylase 126..256 CDD:309300 37/167 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.