DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaB-Ras and CG14669

DIOPT Version :9

Sequence 1:NP_001137613.1 Gene:kappaB-Ras / 35667 FlyBaseID:FBgn0040513 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001262281.1 Gene:CG14669 / 40652 FlyBaseID:FBgn0037326 Length:306 Species:Drosophila melanogaster


Alignment Length:130 Identity:33/130 - (25%)
Similarity:52/130 - (40%) Gaps:22/130 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KVLVCGMKGVGKTALIEQLVYGHVNPETELHPTIEDIYVASV--DTGRGGARETLRIYDTAGLQG 73
            |....|..|||||::::|..| |..|.|....|...||...:  ||   ..|| |.:.|..    
  Fly    96 KAAFLGATGVGKTSILQQFFY-HDFPRTHQTTTHRKIYKNCLVCDT---CIRE-LMVLDVP---- 151

  Fly    74 EQQQLPRHY-----------LQFPDAFVLVYDPMDPRSLDMLADIKADIEKHKEKKEIPVVVLAN 127
            .|::.|...           |:...|:|||||..:..:......::..|......::..::|:.|
  Fly   152 PQKRFPADNFAEWNNGHPLGLRTVHAYVLVYDMGNLETFQYCRSMRDQILDSFSHRDFSIIVVGN 216

  Fly   128  127
              Fly   217  216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaB-RasNP_001137613.1 Ras 11..173 CDD:278499 33/130 (25%)
Ras_like_GTPase 13..174 CDD:206648 32/128 (25%)
CG14669NP_001262281.1 P-loop_NTPase 95..267 CDD:304359 33/130 (25%)
small_GTPase 96..265 CDD:197466 33/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453028
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.