DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaB-Ras and Rap1

DIOPT Version :8

Sequence 1:NP_001137613.1 Gene:kappaB-Ras / 35667 FlyBaseID:FBgn0040513 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001189023.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster

Alignment Length:125 Identity:42/126 (33%)
Similarity:60/126 (48%) Gaps:21/126 (17%)


  Fly    11 KVLVCGMKGVGKTALIEQLV-------YGHVNPETELHPTIEDIYVASVDTGRGGARETLRIYDT 68
            |::|.|..||||:||..|.|       |         .|||||.|...|:.  .|.:..|.|.||
  Fly     5 KIVVLGSGGVGKSALTVQFVQCIFVEKY---------DPTIEDSYRKQVEV--DGQQCMLEILDT 58

  Fly    69 AGLQGEQQQLPRH-YLQFPDAFVLVYDPMDPRSLDMLADIKADIEKHKEKKEIPVVVLAN 127
            ||.  ||....|. |::....|||||......:.:.|.|::..|.:.|:..::|:|::.|
  Fly    59 AGT--EQFTAMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGN 116

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kappaB-RasNP_001137613.1 Ras 11..173 CDD:278499 42/126 (33%)
Ras_like_GTPase 13..174 CDD:206648 41/124 (33%)
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 42/126 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120121255
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.