DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaB-Ras and Nkiras2

DIOPT Version :8

Sequence 1:NP_001137613.1 Gene:kappaB-Ras / 35667 FlyBaseID:FBgn0040513 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001099309.1 Gene:Nkiras2 / 287707 RGDID:1307363 Length:191 Species:Rattus norvegicus

Alignment Length:189 Identity:75/190 (39%)
Similarity:114/190 (60%) Gaps:10/190 (5%)


  Fly     6 IGKVGKVLVCGMKGVGKTALIEQLVYGHVNPETELHPTIEDIYVASVDTGRGGARETLRIYDTAG 70
            :||..||:|||...||||:::|||:||:....:|:..|.|||||.|::|.| |.||.:|.|||.|
  Rat     1 MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDR-GVREQVRFYDTRG 64

  Fly    71 LQGEQQQLPRHYLQFPDAFVLVYDPMDPRSLDMLADIKADIEKHKEKKEIPVVVLAN---VRARA 132
            |: :..:||:|.....|.:||||......|...:..:|.:|:|.|:|||:.:|||.|   ::.:.
  Rat    65 LR-DGAELPKHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQR 128

  Fly   133 APNPVEKVMDRANIWCQRERIKHYTVNAMERPSLYEPFTTLCARLHPMQTKSTFPQLRQ 191
            ..:|     |.|..|.:.|::|.:.|:..:|.||.|||..|.:::...|:||.||..|:
  Rat   129 RVDP-----DVAQHWAKSEKVKLWEVSVADRRSLLEPFIYLASKMTQPQSKSAFPLSRK 182

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kappaB-RasNP_001137613.1 Ras 11..173 CDD:278499 66/165 (40%)
Ras_like_GTPase 13..174 CDD:206648 65/164 (40%)
Nkiras2NP_001099309.1 P-loop_NTPase 6..168 CDD:354812 67/169 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3883
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4285
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002427
OrthoInspector 1 1.000 T618500
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46152
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
98.930

Return to query results.
Submit another query.