DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaB-Ras and inx-14

DIOPT Version :8

Sequence 1:NP_001137613.1 Gene:kappaB-Ras / 35667 FlyBaseID:FBgn0040513 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_492078.1 Gene:inx-14 / 172488 WormBaseID:WBGene00002136 Length:434 Species:Caenorhabditis elegans

Alignment Length:34 Identity:8/35 (23%)
Similarity:14/35 (40%) Gaps:10/35 (29%)


  Fly    24 ALIEQLVY----------GHVNPETELHPTIEDI 47
            |.:::|:|          |.:|.|.....|.|.:
 Worm   126 AYMQKLIYIDMAFIVDYSGKINSEKTFEKTKEKV 159

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kappaB-RasNP_001137613.1 Ras 11..173 CDD:278499 8/35 (23%)
Ras_like_GTPase 13..174 CDD:206648 8/35 (23%)
inx-14NP_492078.1 Innexin 24..397 CDD:279248 8/35 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3883
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.