DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaB-Ras and nkiras2

DIOPT Version :8

Sequence 1:NP_001137613.1 Gene:kappaB-Ras / 35667 FlyBaseID:FBgn0040513 Length:201 Species:Drosophila melanogaster
Sequence 2:XP_002939079.1 Gene:nkiras2 / 100491230 XenbaseID:XB-GENE-482359 Length:190 Species:Xenopus tropicalis

Alignment Length:186 Identity:74/187 (40%)
Similarity:113/187 (60%) Gaps:4/187 (2%)


  Fly     6 IGKVGKVLVCGMKGVGKTALIEQLVYGHVNPETELHPTIEDIYVASVDTGRGGARETLRIYDTAG 70
            :||..||::||..||||||::|||:||:....:::..|.||||:.||:|.| |.||.:|.|||.|
 Frog     1 MGKSCKVVICGQHGVGKTAILEQLLYGNHVVGSDMIETQEDIYIGSVETDR-GVREQVRFYDTRG 64

  Fly    71 LQGEQQQLPRHYLQFPDAFVLVYDPMDPRSLDMLADIKADIEKHKEKKEIPVVVLANVRARAAPN 135
            |: :..:||:|.....|.:||||...:..|...:..:|.:|::.|:|||:.:|||.|........
 Frog    65 LK-DAIELPKHCFCGTDGYVLVYSVDNKDSFKRVEALKKEIDRSKDKKEVTIVVLGNKSDLKDQR 128

  Fly   136 PVEKVMDRANIWCQRERIKHYTVNAMERPSLYEPFTTLCARLHPMQTKSTFPQLRQ 191
            .|:.  |.|..|.:.|::|.:.|:..||.:|.|||.:|.:::...|.||.||..|:
 Frog   129 RVDH--DAAQQWAKAEKVKLWEVSVNERRTLIEPFISLASKMTQPQNKSAFPLSRR 182

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kappaB-RasNP_001137613.1 Ras 11..173 CDD:278499 65/162 (40%)
Ras_like_GTPase 13..174 CDD:206648 64/161 (40%)
nkiras2XP_002939079.1 P-loop_NTPase 6..168 CDD:304359 66/166 (40%)
Ras 6..168 CDD:278499 66/166 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3883
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4367
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002427
OrthoInspector 1 1.000 T601431
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.830

Return to query results.
Submit another query.