DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaB-Ras and nkiras2

DIOPT Version :9

Sequence 1:NP_001137613.1 Gene:kappaB-Ras / 35667 FlyBaseID:FBgn0040513 Length:201 Species:Drosophila melanogaster
Sequence 2:XP_002939079.1 Gene:nkiras2 / 100491230 XenbaseID:XB-GENE-482359 Length:190 Species:Xenopus tropicalis


Alignment Length:186 Identity:74/186 - (39%)
Similarity:113/186 - (60%) Gaps:4/186 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IGKVGKVLVCGMKGVGKTALIEQLVYGHVNPETELHPTIEDIYVASVDTGRGGARETLRIYDTAG 70
            :||..||::||..||||||::|||:||:....:::..|.||||:.||:|.| |.||.:|.|||.|
 Frog     1 MGKSCKVVICGQHGVGKTAILEQLLYGNHVVGSDMIETQEDIYIGSVETDR-GVREQVRFYDTRG 64

  Fly    71 LQGEQQQLPRHYLQFPDAFVLVYDPMDPRSLDMLADIKADIEKHKEKKEIPVVVLANVRARAAPN 135
            |: :..:||:|.....|.:||||...:..|...:..:|.:|::.|:|||:.:|||.|........
 Frog    65 LK-DAIELPKHCFCGTDGYVLVYSVDNKDSFKRVEALKKEIDRSKDKKEVTIVVLGNKSDLKDQR 128

  Fly   136 PVEKVMDRANIWCQRERIKHYTVNAMERPSLYEPFTTLCARLHPMQTKSTFPQLRQ 191
            .|:.  |.|..|.:.|::|.:.|:..||.:|.|||.:|.:::...|.||.||..|:
 Frog   129 RVDH--DAAQQWAKAEKVKLWEVSVNERRTLIEPFISLASKMTQPQNKSAFPLSRR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaB-RasNP_001137613.1 Ras 11..173 CDD:278499 65/161 (40%)
Ras_like_GTPase 13..174 CDD:206648 63/160 (39%)
nkiras2XP_002939079.1 P-loop_NTPase 6..168 CDD:422963 66/165 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 134 1.000 Domainoid score I4968
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4250
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002909
OrthoInspector 1 1.000 - - otm47746
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2273
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.