DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glo1 and glod-4

DIOPT Version :8

Sequence 1:NP_610270.1 Gene:Glo1 / 35656 FlyBaseID:FBgn0283450 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_497827.1 Gene:glod-4 / 175530 WormBaseID:WBGene00006448 Length:281 Species:Caenorhabditis elegans

Alignment Length:153 Identity:33/154 (21%)
Similarity:62/154 (40%) Gaps:45/154 (29%)


  Fly    32 MYRIKDPRKSLPFYTGVLGMTLLVKLDFPE-----------AKFSLYFLGYENATDVPKDPKQRR 85
            ::::.:..|::.|:|.||.|.:|...:|.:           .::|...:||.:..:         
 Worm     9 VFKVANRAKTIDFFTNVLNMKVLRHEEFEKGCEATCNGPYNGRWSKTMIGYGSEDE--------- 64

  Fly    86 SWALSRKATIELTHNWGTERDPDQNYHTGNTDPRGFGHIGIMVPDVYAACQRFQELGVDFVKKPD 150
                  ...:|:|:|:     |...|..|| |.|..         |..:.|.|:::.....:|..
 Worm    65 ------HFVLEITYNY-----PIHKYELGN-DYRAI---------VIDSDQLFEKVEKINHRKSG 108

  Fly   151 DGRMKGLAFIKDPDGYWIEIFNA 173
            .||:.    :|||||:..:|..|
 Worm   109 CGRLA----VKDPDGHEFKIGKA 127

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Glo1NP_610270.1 Glo_EDI_BRP_like 15..173 CDD:301325 32/152 (21%)
glod-4NP_497827.1 Glo_EDI_BRP_like_21 3..127 CDD:176706 32/152 (21%)
Glyoxalase 132..248 CDD:279274
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0346
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.