DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr43a and Gr98a

Sequence 1:NP_001286158.1 Gene:Gr43a FlyBaseID:FBgn0041243 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_651564.1 Gene:Gr98a FlyBaseID:FBgn0039520 Length:391 Species:Drosophila melanogaster

Alignment Length:174 Identity:46/175 (26%)
Similarity:79/175 (45%) Gaps:9/175 (5%)


  Fly   281 ELLKLGYFPAKNKGLLLKSLAD---SHESLGKCVHLLSNSFGIAVLFILVSCLLHLVATAYFLFL 342
            ||.:..|.....:.|.|:.||.   .|.||.:.:..|...|.::::.:|:...:...|..|:|: 
  Fly   196 ELYRTRYEMWSIRRLSLQKLAKLQAIHNSLWQAIRCLECYFQLSLITLLMKFFIDTSALPYWLY- 259

  Fly   343 ELLSKRDNGYLWVQMLWICFHFLRLLMVVEPCHLAAR---ESRKTIQIVCEIERKVHEPILAEAV 404
              ||:.::..:.||........::||.:|.||:|..|   ..||.:.:...:........|..|:
  Fly   260 --LSRVEHTRVAVQHYVATVECIKLLEIVVPCYLCTRCDAMQRKFLSMFYTVTTDRRSSQLNAAL 322

  Fly   405 KKFWQQLLVVDADFSACGLCRVNRTILTSFASAIATYLVILIQF 448
            :....||......|||.|:..:|..:|..|...:.:|:||.|||
  Fly   323 RSLNLQLSQEKYKFSAGGMVDINTEMLGKFFFGMISYIVICIQF 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr43aNP_001286158.1 7tm_7 10..449 CDD:285581 46/175 (26%)
Gr98aNP_651564.1 7tm_7 13..370 CDD:285581 46/175 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.