DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr43a and Gr66a

Sequence 1:NP_001286158.1 Gene:Gr43a FlyBaseID:FBgn0041243 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_523971.3 Gene:Gr66a FlyBaseID:FBgn0035870 Length:527 Species:Drosophila melanogaster

Alignment Length:504 Identity:106/505 (21%)
Similarity:185/505 (37%) Gaps:108/505 (21%)


  Fly    10 IFYISKVLALAPYATVR-NSKGRVEIGRSWLFTVYSATLTVVMVFLTYRGLLFDANSEIPVRASF 73
            :|:|||:..:.|....: .|:..:|..|:.:..:.|   |:::..:.|..|::....|   ..|.
  Fly    18 LFFISKIAGILPQDLEKFRSRNLLEKSRNGMIYMLS---TLILYVVLYNILIYSFGEE---DRSL 76

  Fly    74 RMKSATSKVVTALDVSVV-VMAIVSGVYCGLFSLNDTLELNDRLNKIDNTLN----AYNNFRRDR 133
            :...:|...|..|.::.: ::.:||.....|.:.....||.:|:..:|..|.    ..:|....|
  Fly    77 KASQSTLTFVIGLFLTYIGLIMMVSDQLTALRNQGRIGELYERIRLVDERLYKEGCVMDNSTIGR 141

  Fly   134 WRALGMAAVSLLAISILVG-----LDVGTWMRIAQDMNIAQSDTELNVHWYIPFYSLYFILTGLQ 193
            ...:.:....:..:||||.     :|...||.:.               |.:..... ||.|..:
  Fly   142 RIRIMLIMTVIFELSILVSTYVKLVDYSQWMSLL---------------WIVSAIPT-FINTLDK 190

  Fly   194 VNIANTAYGLGRRFGRLNRMLS---------SSFLAENNAT-----SAIKPQKVSTVKNV----- 239
            :..|.:.|.|..||..:|..|.         ..:|..|...     |:..||..|.::.:     
  Fly   191 IWFAVSLYALKERFEAINATLEELVDTHEKHKLWLRGNQEVPPPLDSSQPPQYDSNLEYLYKELG 255

  Fly   240 -----SVNRPAMPSA--------LHASLTKLN--GETLPSEAAGDKAAARSLILN-VELLKLGYF 288
                 |:.:.::..:        .|:    :|  ||.:  :||..|.....|..| |...:||  
  Fly   256 GMDIGSIGKSSVSGSGKNKVAPVAHS----MNSFGEAI--DAASRKPPPPPLATNMVHESELG-- 312

  Fly   289 PAKNKGLLLKSLADSHESLGKCVHLLSNSFGIAVLFILVSCLLHLVATAYFLFL--------ELL 345
            .|......|.:|...|:.:.:....|:..:...:|.::....|...|..|||:.        .|.
  Fly   313 NAAKVEEKLNNLCQVHDEICEIGKALNELWSYPILSLMAYGFLIFTAQLYFLYCATQYQSIPSLF 377

  Fly   346 SKRDNGYLWVQMLWI----CFHFLRLLMVVEPCHLAARESRKTIQIVCEIERKVH-------EPI 399
            ....|.::.|.:|..    |.:.:.|             |.||.|........:|       :.:
  Fly   378 RSAKNPFITVIVLSYTSGKCVYLIYL-------------SWKTSQASKRTGISLHKCGVVADDNL 429

  Fly   400 LAEAVKKFWQQLLVVDADFSACGLCRVNRTILTSFASAIATYLVILIQF 448
            |.|.|.....:||....||||||...::...|...:..|.:||:|||||
  Fly   430 LYEIVNHLSLKLLNHSVDFSACGFFTLDMETLYGVSGGITSYLIILIQF 478

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr43aNP_001286158.1 7tm_7 10..449 CDD:285581 106/505 (21%)
Gr66aNP_523971.3 7tm_7 21..478 CDD:285581 104/500 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C1WA
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.