DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr43a and Gr57a

Sequence 1:NP_001286158.1 Gene:Gr43a FlyBaseID:FBgn0041243 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_523798.1 Gene:Gr57a FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster

Alignment Length:439 Identity:88/440 (20%)
Similarity:169/440 (38%) Gaps:135/440 (31%)


  Fly    70 RASFRMKSATSKVVTALDVSVVVMAIVSGVYCGLF-SLNDTL---ELNDRLNKIDNTLNAYNNFR 130
            |::||:..|:         .:..|::....:|.|| ||:..|   ::.:||.|.||.:       
  Fly    36 RSTFRISWAS---------RIYSMSVAIAAFCCLFGSLSVLLAEEDIRERLAKADNLV------- 84

  Fly   131 RDRWRALGMAAVSLLAISILVGLDVGTWMRIAQDMNIAQSDTELNVHWYIPFYSLYFILTGLQVN 195
                  |.::|:.||..:::.|:.|                                  ..||| 
  Fly    85 ------LSISALELLMSTLVFGVTV----------------------------------ISLQV- 108

  Fly   196 IANTAYGLGRRFGRLNRMLSSSF---------LAENNATSAIKPQKVSTVKNVSVNRPAMPSAL- 250
            .|....|:.:|...|:..|.|.|         |.:|.|...|    |:|:..:::|..|:..|. 
  Fly   109 FARRHLGIYQRLAALDARLMSDFGANLNYRKMLRKNIAVLGI----VTTIYLMAINSAAVQVASG 169

  Fly   251 HASL--------TKLNG---------ETLPSEAAGDKAAARSLILNVELLKLGYFPAKNKGLLLK 298
            |.:|        |.:.|         .|| :|..|.:......:|..|.|...:.....:.|.::
  Fly   170 HRALFLLFALCYTIVTGGPHFTGYVHMTL-AEMLGIRFRLLQQLLQPEFLNWRFPQLHVQELRIR 233

  Fly   299 SLADSHESLGKCVHLLSNSFGIAVLFILVSCLLHLVATAYFLFLELL-----SKRDNGYLWVQML 358
            .:....:.|...:..::..:.:::...:...|....:..|.||.:.:     ::.:||..: :||
  Fly   234 QVVSMIQELHYLIQEINRVYALSLWAAMAHDLAMSTSELYILFGQSVGIGQQNEEENGSCY-RML 297

  Fly   359 WICFHFLRLLMV-------VEP--CHLAARESRKTIQIVCEIE---------RKVHEPILA---E 402
                .:|.|:|:       :.|  |.....|:|:.:::|.:::         |.:.|.:::   :
  Fly   298 ----GYLALVMIPPLYKLLIAPFYCDRTIYEARRCLRLVEKLDDWFPQKSSLRPLVESLMSWRIQ 358

  Fly   403 AVKKFWQQLLVVDADFSACGLCRVNRTILTSFASAIATYLVILIQFQRT 451
            |..:|...|.||           ::|.::..|.|.:..||:|||||..|
  Fly   359 AKIQFTSGLDVV-----------LSRKVIGLFTSILVNYLLILIQFAMT 396

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr43aNP_001286158.1 7tm_7 10..449 CDD:285581 87/436 (20%)
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 88/440 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.