DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr43a and Gr22e

Sequence 1:NP_001286158.1 Gene:Gr43a FlyBaseID:FBgn0041243 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_722731.1 Gene:Gr22e FlyBaseID:FBgn0045497 Length:389 Species:Drosophila melanogaster

Alignment Length:471 Identity:114/472 (24%)
Similarity:178/472 (38%) Gaps:129/472 (27%)


  Fly     9 GIFYISKVLALAPYA------TVRNSKGRVEIGRSWLFTVYSATLTVVMVFLTYRGLLFDANSEI 67
            |..|.|.:|.:.|:|      |:|.||        ||. .|...|....:.|....   |..||.
  Fly    20 GALYGSWILGVFPFAYDSWTRTLRRSK--------WLI-AYGFVLNAAFILLVVTN---DTESET 72

  Fly    68 PVRASFRMKSATSKVVTALDVSVVVMAIVSGVYCGLFSLNDTLELNDRLNKIDNTLNAYNNFRR- 131
            |:|.....::|.::.:..:. .:..:::||.:....|..:..:|..  ||::::..:.|  ||. 
  Fly    73 PLRMEVFHRNALAEQINGIH-DIQSLSMVSIMLLRSFWKSGDIERT--LNELEDLQHRY--FRNY 132

  Fly   132 --------DRWRALGMAAVSLLAISILVGLDVGTWMRIAQDMNIAQSDTELNVHWYIPFYSLYFI 188
                    ||:......:|.|..:|:|| |::|                      ..|.||..|.
  Fly   133 SLEECISFDRFVLYKGFSVVLELVSMLV-LELG----------------------MSPNYSAQFF 174

  Fly   189 LTGLQVNIANTAYGLGRRFGRLNRMLSSSFLAENNATSAIKPQKVSTVKNV-SVNRPAMPSALHA 252
            :            ||    |.|..||.:..|..::...|:    |...:.| .|||..:......
  Fly   175 I------------GL----GSLCLMLLAVLLGASHFHLAV----VFVYRYVWIVNRELLKLVNKM 219

  Fly   253 SLTKLNGETLPSEAAGDKAAARSLILNVELLKLGYFPAKNKGLLLKSLADSHESLGKCVHLLSNS 317
            ::    |||:.||             .::||...|....:.|..|.|:.|....:.....|::|.
  Fly   220 AI----GETVESE-------------RMDLLLYLYHRLLDLGQRLASIYDYQMVMVMVSFLIANV 267

  Fly   318 FGIAVLFILVSCLLHLVATAYFLFLELLSKRDNGYLWVQMLWICFHFLRLLMVVEPCHLAARESR 382
            .|| ..||:.|..|:     ..|..::|       ::||.|.|  :.|...:.||.|.||.|..|
  Fly   268 LGI-YFFIIYSISLN-----KSLDFKIL-------VFVQALVI--NMLDFWLNVEICELAERTGR 317

  Fly   383 KTIQI------VCEIERKVHEPILAEAVKKFWQQLLVVDADFSACGLCRVN-----RTILTSFAS 436
            :|..|      :..|:.|:...|...|:....::|     .|..|||..||     |..:|||  
  Fly   318 QTSTILKLFNDIENIDEKLERSITDFALFCSHRRL-----RFHHCGLFYVNYEMGFRMAITSF-- 375

  Fly   437 AIATYLVILIQFQRTN 452
               .||:.||||...|
  Fly   376 ---LYLLFLIQFDYWN 388

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr43aNP_001286158.1 7tm_7 10..449 CDD:285581 112/466 (24%)
Gr22eNP_722731.1 7tm_7 18..388 CDD:285581 113/470 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.