DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr43a and Gr36c

Sequence 1:NP_001286158.1 Gene:Gr43a FlyBaseID:FBgn0041243 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_724040.1 Gene:Gr36c FlyBaseID:FBgn0045485 Length:390 Species:Drosophila melanogaster

Alignment Length:496 Identity:83/497 (17%)
Similarity:165/497 (33%) Gaps:159/497 (32%)


  Fly     1 MEISQPSIG-IFYISKVLALAPYATVRNSKGRVEIGRSWLFTVYSATL-TVVMVFLTYRGLLFDA 63
            |::....:| ::|....:.|:.:....|: ||| ..:.| .|:|:..| :.:.....|.   :..
  Fly     1 MDLESFLLGAVYYYGLFIGLSNFEFDWNT-GRV-FTKKW-STLYAIALDSCIFALYIYH---WTG 59

  Fly    64 NSEIPVRASFRMKSATSKVVTALDVSVVVMAIVSGVYCGLFSLNDTLELNDRLNKIDNTLNAYNN 128
            |:.| |.|.|...:...:.|.|:   :..:.||:|::..:.......::.|..:|:.....|...
  Fly    60 NTNI-VNAIFGRANMLHEYVVAI---LTGLRIVTGLFTLILRWYQRCKMMDLASKVVRMYVARPQ 120

  Fly   129 FRR-DRW----------------RALGMAAVSLLAISILVGLDVGTWMRIAQDMNIAQSDTELNV 176
            .|| .||                .|:.::|:..:.....:||.:..||.:..:|.:.|.      
  Fly   121 VRRMSRWGILTKFIFGSITDGLQMAMVLSAMGSVDSQFYLGLGLQYWMFVILNMAMMQQ------ 179

  Fly   177 HWYIPFYSLYFILTGLQVNIANTAYGLGRRFGRLNRMLSSSFLAENNATSAIKPQKVSTVKNVSV 241
            |..     :.|:.|  |..:.||         .|.:::..                         
  Fly   180 HMI-----MLFVRT--QFQLINT---------ELRQVIDE------------------------- 203

  Fly   242 NRPAMPSALHASLTKLNGETLPSEAAGDKAAARSLILNVELLKLGYFPAKNKGLLLK---SLADS 303
                                           |:.|:|:          .:::|:.:.   ||||.
  Fly   204 -------------------------------AKDLLLS----------PRHQGVFMTKCCSLADQ 227

  Fly   304 HESLGK-------CVHLLSNSFGIAVLFILVSCLLHLVATAYFLFLELLSKRDN----------G 351
            .|::.:       .::.:...|||..........|..|.|.|..:..|....:|          .
  Fly   228 IENIARIQSQLQTIMNQMEEVFGIQGAMTYGGYYLSSVGTCYLAYSILKHGYENLSMTLSTVILA 292

  Fly   352 YLWVQMLWICFHF-------LRLLMVVEPCHLAARE--SRKTIQIVCEIERKVHEPILAEAVKKF 407
            |.|      ||.:       |.:::.|:..:....:  .::||.:..::.       |.||.:..
  Fly   293 YSW------CFFYYLDGMLNLSVMLHVQDDYWEMLQILGKRTIFVGLDVR-------LEEAFENL 344

  Fly   408 WQQLLVVDADFSACGLCRVNRTILTSFASAIATYLVILIQF 448
            ..||:......:...|..|.|:...:....:.|:.:.|||:
  Fly   345 NLQLIRNPLKITVVKLYDVTRSNTMAMFGNLITHSIFLIQY 385

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr43aNP_001286158.1 7tm_7 10..449 CDD:285581 81/487 (17%)
Gr36cNP_724040.1 7tm_7 8..389 CDD:285581 82/490 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.