DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr43a and Gr58a

Sequence 1:NP_001286158.1 Gene:Gr43a FlyBaseID:FBgn0041243 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_726135.2 Gene:Gr58a FlyBaseID:FBgn0041239 Length:395 Species:Drosophila melanogaster

Alignment Length:458 Identity:93/459 (20%)
Similarity:163/459 (36%) Gaps:124/459 (27%)


  Fly    29 KGRVEIG--RSWLFTVYSAT----LTVVMVFLTYRGLLFDAN--SEIPV-RASFRMKSATSKVVT 84
            ||:..:|  :.| :.:|:|.    |..|:.| |:...::|.:  |..|| :.:|.:.:.|.    
  Fly    22 KGQFLLGYKQRW-YLIYTACLHGGLLTVLPF-TFPHYMYDDSYMSSNPVLKWTFNLTNITR---- 80

  Fly    85 ALDVSVVVMAIVSGVYCGLFSLNDTLELNDRL-------NKIDNTLNAYNNFRRDRWRALGMAAV 142
                   :||:.|||....|.....|.|.:.|       ..:||....|:..|: |.|.:....:
  Fly    81 -------IMAMFSGVLLMWFRRKRILNLGENLILHCLKCKTLDNRSKKYSKLRK-RVRNVLFQML 137

  Fly   143 SLLAISILVGLDVGTWMRIAQDMNIAQSDTELNVHWYIPFYSLYFILTGLQVNIANTAYGLGRRF 207
            .:..:|||:|..:  ..||.....|  |.|.:.|.....|..:.|::||:.|             
  Fly   138 LVANLSILLGALI--LFRIHSVQRI--SKTAMIVAHITQFIYVVFMMTGICV------------- 185

  Fly   208 GRLNRMLSSSFLAENNATSAIKPQKVSTVKNVSVNRPAMPSALHASLTKLNGETLPSEAAGDKAA 272
                                     :..|.:....|  :..||....:.||.|...|....:..|
  Fly   186 -------------------------ILLVLHWQSER--LQIALKDLCSFLNHEERNSLTLSENKA 223

  Fly   273 ARSLILNVELLKLGYFPAKNKGLLLKSLADSHESLGKCVHLLSNSFGIAVLFILVSCLLHLVATA 337
            .|||....:|.||.   |:|:.|               |..:..:|.:.:..:|:...:..|...
  Fly   224 NRSLGKLAKLFKLF---AENQRL---------------VREVFRTFDLPIALLLLKMFVTNVNLV 270

  Fly   338 YFLF------LELLSKRDNGYLWVQMLWICF-HF---LRLLMVVEPCHLAARESRKTIQIVCEIE 392
            |...      :|..|     |..:...|:.. |:   :.|:.||:  .:..|...|...::.|..
  Fly   271 YHGVQFGNDTIETSS-----YTRIVGQWVVISHYWSAVLLMNVVD--DVTRRSDLKMGDLLREFS 328

  Fly   393 RKVHEPILAEAVKKFWQQLLVVDAD--------FSACGLCRVNRTILTSFASAIATYLVILIQFQ 449
            .       .|.||:.:...|.:.:|        :..|||...|:....::...:...:::|:||.
  Fly   329 H-------LELVKRDFHLQLELFSDHLRCHPSTYKVCGLFIFNKQTSLAYFFYVLVQVLVLVQFD 386

  Fly   450 RTN 452
            ..|
  Fly   387 LKN 389

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr43aNP_001286158.1 7tm_7 10..449 CDD:285581 92/454 (20%)
Gr58aNP_726135.2 7tm_7 3..373 CDD:285581 89/441 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.