DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Br140 and Mllt6

DIOPT Version :10

Sequence 1:NP_610266.1 Gene:Br140 / 35648 FlyBaseID:FBgn0033155 Length:1430 Species:Drosophila melanogaster
Sequence 2:XP_006533395.1 Gene:Mllt6 / 246198 MGIID:1935145 Length:1109 Species:Mus musculus


Alignment Length:88 Identity:18/88 - (20%)
Similarity:42/88 - (47%) Gaps:11/88 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 TKQKSDGDDDDPLSYCPKAATKSLPYGRGTKRKREECFEMALETNRSLIAVMKTSLTVQKELVAE 260
            |:.|.:..:.||.:|...:..:.|    .||..    ::..:::...:.|.|:   .|..||...
Mouse   239 TETKINEVNVDPAAYLRSSQKEVL----NTKPD----YQRIVQSQNEVFAYME---LVMDELQGA 292

  Fly   261 VRGLKKVLEEFTESMRELNGGLR 283
            |:.|:..::|.|:.:::::..|:
Mouse   293 VKQLQAFMDESTQYLQKVSVQLK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Br140NP_610266.1 SFP1 <22..61 CDD:227516
COG5141 203..>625 CDD:227470 16/81 (20%)
Bromo_brd1_like 615..712 CDD:99944
MSCRAMM_ClfA <1080..1163 CDD:468110
PWWP_BRPF 1303..1414 CDD:438964
Mllt6XP_006533395.1 PHD_AF10_AF17 7..54 CDD:277049
ePHD_AF17 61..185 CDD:277179
CC_AF10 719..773 CDD:411015
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.