DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Spn43Ad and Spn88Eb

Sequence 1:NP_610261.1 Gene:Spn43Ad FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_650427.1 Gene:Spn88Eb FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster

Alignment Length:450 Identity:95/450 (21%)
Similarity:163/450 (36%) Gaps:94/450 (21%)


  Fly     6 LLSALLVGLAIALTLPVDGELLARSPASVSSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLL 70
            ||:.|.|....||..|....|...|........|.|.|..::....|..|:..||.....||.|.
  Fly     8 LLALLPVVTIAALDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLA 72

  Fly    71 YAESSSEYGSQLRQALELTHASHPKLAVQDFETLLTDLKQSAAIGCRLRLLSDLY---------- 125
            |..||.:...:|.|||.|..|.:               ||...:...|....|.:          
  Fly    73 YFSSSEQTERELAQALNLGWALN---------------KQQVLVSYTLAQRQDEFRWRQSPMELS 122

  Fly   126 -AQQRF---TFNFRNEFETLAARMGVGCHRLSWES-ASNAAQDINYAFLSRSNFSLGELVSAPQL 185
             |.:.|   |.|..|:|.||   :......|.::: .....::||.....:::..:.:::|:   
  Fly   123 SANRIFVDRTINVSNKFNTL---LYGATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSS--- 181

  Fly   186 ESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQHRYRYAEVPALDA 250
            |.:..| |..:..:....:..|...|...||....||.......:|..|.....::......|.:
  Fly   182 EEITPH-TMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQS 245

  Fly   251 QLIEVPFAT---------------ADLRMLIVFPNRPDGLAQLERKLAQSDLHQLRSQLEE---R 297
            |:|::|:.|               :|:.|:|:.||  .....|.|.:::.:...::...|.   :
  Fly   246 QIIKLPYRTIYKSKETHISTPESKSDISMIIILPN--SNKISLNRVISRLNADSVKKWFERALPQ 308

  Fly   298 KVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSAPPLGAVVQS----GLLE 358
            |:.|:|||.:.....:|..:|..:|:..:||......::       :|.|:..|:..    ..::
  Fly   309 KIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDL-------TADPISLVIDDAQHLAKIK 366

  Fly   359 LQEDGGNA--------------DDSFSFGDLFRRALPLVINHPFFYAIGNGK--TLLLSG 402
            :.|.|..|              .|...|.          .||||.:.|.:.|  |:|.:|
  Fly   367 VDEVGSTAAAATILLVSRSSRQPDPTKFN----------CNHPFVFLIYDEKVDTILFAG 416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 86/421 (20%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 86/421 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C22675530
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D556621at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11461
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.