DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp9b2 and Cyp6a8

Sequence 1:NP_523646.1 Gene:Cyp9b2 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster

Alignment Length:535 Identity:163/536 (30%)
Similarity:262/536 (49%) Gaps:78/536 (15%)


  Fly     3 LIEICLALV-VIGYLIYKWSTATFKTFEERKLYFEKPYPFVGNMAAAALQKSS-----FQRQLTE 61
            |.::.:||: ::.|.|::..|    .|:.|.:.|..|:...|||  ..|||:.     ||    :
  Fly     7 LFQVAVALLAILTYYIHRKLT----YFKRRGIPFVAPHLIRGNM--EELQKTKNIHEIFQ----D 61

  Fly    62 FYERTRQHK--LVGFFNMRTPMITLNDPELIKKVCVKDFDHFPNHQPFITSND-----RLFNDML 119
            .|.:.|:.|  .||||..::|...:.|.||.|::.:|||.:|.|...|....|     .|||   
  Fly    62 HYNKFRESKAPFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDDPISAHLFN--- 123

  Fly   120 SVMRDQRWKHMRNTLTPVFTAAKMRNMF-----------TLMNESFAECLQHLDSSSKTLPGRKG 173
              :...:|:.:||.|:..||:.||:.|:           |:|:|.              :|  |.
  Fly   124 --LDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEK--------------VP--KN 170

  Fly   174 FEVDMKVMCNKLSNDIIATTAFGLKVNSYDNPKNEFYEIG-QSLVFSR-GLQFFKFMLSTLVPKL 236
            ..::::.:..:.:.|:|.|.|||::.||..:.|.||...| :|||..| |.....||.|  .|||
  Fly   171 SVLEIRDLVARFTVDVIGTCAFGIQCNSLRDEKAEFLYFGKRSLVDKRHGTLLNGFMRS--YPKL 233

  Fly   237 FSLLKLTIFDSAKVDYFARLVVEAMQYREKHNITRPDMIQLLMEAKNESE---------DKWTDD 292
            ...|.:........::::|:|.|.:..|||.:|.|.|.:.:|:|.||:.|         ...|.:
  Fly   234 ARKLGMVRTAPHIQEFYSRIVTETVAVREKEHIKRNDFMDMLIELKNQKEMTLENGDVVRGLTME 298

  Fly   293 EIVAQCFIFFFAAFENNSNLICTTTYELLYNPDVQERL---YEEIVETKKALNGAPLTYDAVQKM 354
            |::||.|:||.|.||.:|:.:....|||..|||:|:::   .||::|.    :....||:..:.:
  Fly   299 EVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQ----HDQNFTYECTKDL 359

  Fly   355 TYMDMVISESLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKVGDRINIPISGLHLDDRYFPEPR 419
            .|::.|:.|:||.:|:....||:.:|.|.:   .|...|..:.|..:.||.|.:|.|...:|||.
  Fly   360 KYLNQVLDETLRLYTIVPNLDRMAAKRYVV---PGHPNFVIEAGQSVIIPSSAIHHDPSIYPEPF 421

  Fly   420 KFDPDRFSEERKGDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLFNLLLHYKIEASPRTIKDLWG 484
            :|.|:|||.|.........:||||.|||||||.|:..||.:..|..|:.::|.....:|...|..
  Fly   422 EFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCSKTPNPLVY 486

  Fly   485 SASGFNFTPRSGFWM 499
            ....|....:.|.::
  Fly   487 DPKSFVLGVKDGIYL 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 150/478 (31%)
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 154/500 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49880
eggNOG 1 0.900 E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1576
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 1 1.100 P PTHR24292
RoundUp 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.