DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and AT2G20230

DIOPT Version :8

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_565468.1 Gene:AT2G20230 / 816542 AraportID:AT2G20230 Length:270 Species:Arabidopsis thaliana

Alignment Length:111 Identity:26/112 (23%)
Similarity:42/112 (38%) Gaps:40/112 (36%)


  Fly    42 AIGILI----LGGTILVISLFGCCGAVRESPRMLWTYASLLLILLLL---IVAFIILNPKDVFKK 99
            |:|||:    ..|.|...::.|||         |..|:.|..:|:||   :||:|          
plant   106 AVGILVCIVTFIGFIAAEAINGCC---------LCFYSILKTLLILLEAALVAYI---------- 151

  Fly   100 YALQTVENQWE--LEQTKPGSMDIIQKTYYCCGRDSAQDYLDIKFW 143
                .::..||  |.....|.:..:        |...::.:||..|
plant   152 ----AIDRHWEKDLPYDPTGELSSL--------RAFIEENIDICKW 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 26/112 (23%)
tetraspanin_LEL 94..178 CDD:239401 8/53 (15%)
AT2G20230NP_565468.1 Tetraspannin 74..>160 CDD:278750 20/77 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19282
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.