DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and Tsp47F

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster


Alignment Length:254 Identity:78/254 - (30%)
Similarity:113/254 - (44%) Gaps:64/254 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CATGTIKYSLFLFNALWAILGILVLIFGGLGWGAMPD-------------AYAIGILILGGTILV 54
            |....|||.||.||.|:||.|:.:||.|.:   .:.|             |..|.:::.|..|.:
  Fly     4 CGPSLIKYVLFAFNVLFAISGLGILIAGAV---VLADVNEFNHFVEGRVLAPPIVLIVTGLIIFL 65

  Fly    55 ISLFGCCGAVRESPRMLWTYASLLLILLLLIVAFIILNPKDVFKKYALQTVENQWELEQTKPGSM 119
            |:..||.||::|||.:|.|:|.||.::.::.:|..|  ...||||.....|:|..:....:..|.
  Fly    66 IASLGCFGAIKESPTLLITFAVLLAVIFIVELAVGI--AASVFKKDLEGMVKNSLQESIKRSNSE 128

  Fly   120 DI-----IQKTYYCCGRDSAQDYLDIKFWNNTVPSSCCKD---DSCVNPLNLYVRGCLIKVEEAF 176
            |.     ||:...|||.||..|:..:.. |.|:|.|||:.   ||.|.       .||       
  Fly   129 DTMAWDNIQQKLMCCGVDSPADWRTLSA-NKTLPGSCCQPQYIDSTVG-------HCL------- 178

  Fly   177 ADEATTLG---YLEWGLLG-------FNAVIL-----------LLAIILAIHYTNRRRR 214
              |:..||   |.:.|.:|       .||:||           :|.|:||.:..|..|:
  Fly   179 --ESPALGKDKYFQVGCVGKLKDRIEKNAIILIGVGIGIAFIQILGIVLACYLANSIRQ 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 68/219 (31%)
tetraspanin_LEL 94..178 CDD:239401 27/91 (30%)
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 76/245 (31%)
uroplakin_I_like_LEL 102..205 CDD:239409 33/119 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442945
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.