DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and Tsp42Eh

DIOPT Version :8

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster

Alignment Length:234 Identity:63/235 (27%)
Similarity:111/235 (47%) Gaps:21/235 (9%)


  Fly     1 MGCATGTIKYSLFLFNALWAILGILVLIFGG------------LGWGAMPDAYAIGILILGGTIL 53
            |.|.|..::|.|.:.:.:.|:.|.|::.:|.            ||.....|..|:..::||..|:
  Fly     1 MYCTTRLLRYVLCVISGICALGGCLLIWYGAWLLDSLSEEQRMLGMDHGEDLAAVLCVLLGTVIV 65

  Fly    54 VISLFGCCGAVRESPRMLWTYASLLLILLLLIVAFIILN---PKDVFKKYALQTVENQWELEQTK 115
            |.|:||.....::|..:|..||.||:.||::.:..:.::   .:|.......|.:::.|:|:...
  Fly    66 VASIFGSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAASRDFLPDSLRQGLDDLWDLQHEG 130

  Fly   116 PGSMDIIQKTYYCCGRDSAQDYLDIKFWNNTVPSSCCKDDSCVNPLNLYVRGCLIKVEEAFADEA 180
            ..:::..::..:||||:||:|||.::   ...|.|||.:..|...|||::.||.:|.:|....:.
  Fly   131 NSTLNTYEEWLHCCGRNSAEDYLHLE---KMPPPSCCLNRDCTKHLNLFMTGCEVKFKEYVGAKT 192

  Fly   181 TTLGYLEWGLLGFNAVILLLAIILAIHYTNRRRR---YN 216
            .....|.|.|:.|.....:....|.....|.|.|   ||
  Fly   193 ANFHSLSWFLVIFEFAGSVTTCYLVDSIRNHRDRIRFYN 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 54/204 (26%)
tetraspanin_LEL 94..178 CDD:239401 25/84 (30%)
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 55/215 (26%)
tetraspanin_LEL 109..192 CDD:239401 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134119523
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D570819at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19282
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.