DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and Tsp29Fa

DIOPT Version :8

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster

Alignment Length:241 Identity:65/242 (27%)
Similarity:111/242 (46%) Gaps:56/242 (23%)


  Fly     1 MGCATGT---IKYSLFLFNALWAILGILVLIFGGLGWGAMPDAYAI-----------GILILGGT 51
            |...||:   :||:||.||.::.|.|| :||..|.|.||:...|.:           .::::|..
  Fly     1 MSLLTGSANAVKYTLFGFNLIFLITGI-ILIAVGAGVGAVYTGYKLFLAGKFFSIPTFLIVIGSF 64

  Fly    52 ILVISLFGCCGAVRESPRMLWTYASLLLILLLL-----IVAFIILN-PKDVFK---KYALQTVEN 107
            |::||.|||.||::|:..::.:::.:|.|:.:|     |..:::.| ..|:.|   .|:|.    
  Fly    65 IIIISFFGCWGALKENYCLVLSFSVMLAIIFILELAAGISGYVLRNDASDLIKTSLTYSLN---- 125

  Fly   108 QWELEQTKPGS----MDIIQKTYYCCGRDSAQDYLDIKFWNNTVPSSCCK-------DDSCVNP- 160
              |.....|.:    .|.||..:.|||..|..|:: ..|.|..:|.|||.       ..:|.|. 
  Fly   126 --EYNSINPNATTKLWDDIQDEFECCGVTSYNDWI-TAFPNGDLPISCCNVHVGAVGTFTCNNAQ 187

  Fly   161 ---LNLYVRGCLIKVEEAFADEATTLGYLEWGLLGFNAVILLLAII 203
               .:.:..|||    :.|:      ||:....:...|..:::||:
  Fly   188 SSVADRHKVGCL----DGFS------GYISAHAVSLGAAGVVIAIL 223

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 60/227 (26%)
tetraspanin_LEL 94..178 CDD:239401 26/102 (25%)
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 62/232 (27%)
tetraspanin_LEL 106..210 CDD:239401 29/121 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122032069
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19282
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.