DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17002 and Gps2

DIOPT Version :8

Sequence 1:NP_610253.1 Gene:CG17002 / 35610 FlyBaseID:FBgn0033122 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_017170173.1 Gene:Gps2 / 56310 MGIID:1891751 Length:402 Species:Mus musculus

Alignment Length:477 Identity:109/478 (23%)
Similarity:182/478 (38%) Gaps:175/478 (37%)


  Fly    10 SNAAAQAAKAERAEKLRGALKGFIVADRQR-RQEE------FEAQCEEQRLRREREEVERQNQVA 67
            |||.|:            ||...|:.:|:| ||||      .|.:.:|::.||:::|:|  .:::
Mouse    11 SNAMAR------------ALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEME--ERMS 61

  Fly    68 LDDTRGQITRLDEQLADLHSQKHQLTVQLKKVLNEDETRKKLAKENELFAIQQAAASSPVFLPPL 132
            |::|:.||.:|.|:|:.|..:||||.:||||||:|:|.|:: .::::|..:..||....:.:   
Mouse    62 LEETKEQILKLQEKLSALQEEKHQLFLQLKKVLHEEEKRRR-KEQSDLTTLTSAAYQQSLTV--- 122

  Fly   133 RLQHQHHTLMQKLPSGGQPGKRGRSPSPPSQQQA-------------YYKSAASYA-QQKHDDYR 183
                  ||....|...|.||...|..:..:..:|             |..|||::| ..:|    
Mouse   123 ------HTGTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEH---- 177

  Fly   184 RAADYARLSWNKTAAQYPGTGTVFYQTVAPP-----------PTTQHQADARLQSIYNYNLPLRQ 237
                          .|:.|:....|.|..||           |:.|.:|.:...::...:.|..|
Mouse   178 --------------GQFQGSPGGAYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQPQPQ 228

  Fly   238 AYHVD---LPSAT----VSKPPDSQSPKAPSQSQPMQVLHINLDQPTISQADLVAQAGGSLSVKA 295
            .|.|.   .|:.|    :.:.|..:||.|....|            |:..:..: |.|.:||::.
Mouse   229 PYAVHGHFQPTQTGEIPLGRSPTFRSPTATCSFQ------------TLLPSGFL-QPGSTLSLQK 280

  Fly   296 SQPHVTMEKL-----------PDRYH------------IEVKHDGQPPSHVPPPPHLLPEGVIFK 337
            ...|...:..           |...|            ::::..|:.   :|||.:|.|:     
Mouse   281 QMEHANQQTSFSDSSSLRPMHPQALHPAPGLLASPQLPVQIQAAGKA---LPPPANLAPD----- 337

  Fly   338 PLLNELSLHSNVLQISSSQFPPQNPKTAGSITQGYAPGRGGSAHEQQLARQQLAMLPGQPGAPSG 402
                  ||.||            ..:|..|||         |.|::               ||  
Mouse   338 ------SLSSN------------TARTQDSIT---------SNHQR---------------AP-- 358

  Fly   403 SGSAQPPP---GQQMHYTRRLY 421
               |.||.   |..:..|.::|
Mouse   359 ---AHPPSLRLGSYVPQTNKMY 377

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17002NP_610253.1 G_path_suppress 23..271 CDD:292610 73/287 (25%)
Gps2XP_017170173.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C169977805
eggNOG 1 0.900 E1_298IM
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5206
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007195
OrthoInspector 1 1.000 T1082988
orthoMCL 1 0.900 OOG5_134633
Panther 1 1.100 LDO PTHR22654
Phylome 1 0.910 0.875 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5091
TreeFam 1 0.960
1110.780

Return to query results.
Submit another query.