DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17002 and gps2

DIOPT Version :8

Sequence 1:NP_610253.1 Gene:CG17002 / 35610 FlyBaseID:FBgn0033122 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_017211536.1 Gene:gps2 / 393948 ZFINID:ZDB-GENE-040426-1176 Length:370 Species:Danio rerio

Alignment Length:437 Identity:111/438 (25%)
Similarity:167/438 (38%) Gaps:148/438 (34%)


  Fly    10 SNAAAQAAKAERAEKLRGALKGFIVADRQR-RQEEFEA-QCEEQRLRRERE---EVERQNQVALD 69
            |||.|:            ||...|:.:|:| ||||.|. :..||:|:.|.|   :.|.:.:::|:
Zfish    20 SNAMAR------------ALHKHIMRERERKRQEEEEVDKMMEQKLKEEEERKRKKEMEERMSLE 72

  Fly    70 DTRGQITRLDEQLADLHSQKHQLTVQLKKVLNEDETRKKLAKENELFAIQQAAASSPVFLPPLRL 134
            :|:.||.::..:|..|..:||||.:||||||:|:|.|:: .:::::..:..|...:.:.:.|   
Zfish    73 ETKEQIMKMGVKLQGLQEEKHQLFLQLKKVLHEEEKRRR-KEQSDMTTLTSATYQANMPIHP--- 133

  Fly   135 QHQHHTLMQK-LPSGGQP----GKRGR----SPSPPS---QQQAYYKSAASYAQQKHDDYRRAAD 187
             .||...||. ..|.|:|    |:|.:    ||..|:   |.|..:.:..|    :|..|     
Zfish   134 -SQHILSMQAGQVSHGRPAVLLGERSKQLFQSPVIPARHFQSQPGFSAGGS----EHGQY----- 188

  Fly   188 YARLSWNKTAAQYPGTGTVFYQTVAPPPTTQHQADARLQSIYNYNLPLRQAYHVDLPSATVSKPP 252
                    :.|| ||.        :|...||.|                   |.           
Zfish   189 --------SGAQ-PGH--------SPYGVTQTQ-------------------HT----------- 206

  Fly   253 DSQSPKAPSQSQPMQVLHINLDQPTISQADLVAQAGGSLSVKASQPHVTMEKLPDRYHIEVKHDG 317
               ||.|.||..|                   |....|..::.:....||:.||.:......|  
Zfish   207 ---SPFASSQPVP-------------------ANYASSSQLRGASAFQTMQYLPHQQQGYAVH-- 247

  Fly   318 QPPSHVPPPPHLLPEGVIFKPLLNELSLHSNVLQ--ISSSQFPPQNPK----TAGS------ITQ 370
               ||....|..:|...|  ||..:|. |:|...  ..||...|.:|:    :|.|      |..
Zfish   248 ---SHFTSQPGYIPSAGI--PLQKQLE-HANQQSGFTDSSPLRPMHPQALHVSAASLLSTPPIAV 306

  Fly   371 GYAPGRGGSA--HEQQLARQQLAMLPGQPGAPSGSGSAQPPPGQQMH 415
            ...||:.|.:  |.|:         |..|||.|     ...|.||.|
Zfish   307 QIPPGKSGISYTHSQR---------PASPGAFS-----HGTPSQQAH 339

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17002NP_610253.1 G_path_suppress 23..271 CDD:292610 69/265 (26%)
gps2XP_017211536.1 G_path_suppress 14..304 CDD:318248 96/387 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C169978623
eggNOG 1 0.900 E1_298IM
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5325
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007195
OrthoInspector 1 1.000 T1052306
orthoMCL 1 0.900 OOG5_134633
Panther 1 1.100 LDO PTHR22654
Phylome 1 0.910 0.875 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5091
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.