DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17002 and GPS2

DIOPT Version :8

Sequence 1:NP_610253.1 Gene:CG17002 / 35610 FlyBaseID:FBgn0033122 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_004480.1 Gene:GPS2 / 2874 HGNCID:4550 Length:327 Species:Homo sapiens

Alignment Length:424 Identity:103/425 (24%)
Similarity:161/425 (38%) Gaps:146/425 (34%)


  Fly    10 SNAAAQAAKAERAEKLRGALKGFIVADRQR-RQEE------FEAQCEEQRLRREREEVERQNQVA 67
            |||.|:            ||...|:.:|:| ||||      .|.:.:|::.||:::|:|  .:::
Human    11 SNAMAR------------ALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEME--ERMS 61

  Fly    68 LDDTRGQITRLDEQLADLHSQKHQLTVQLKKVLNEDETRKKLAKENELFAIQQAAASSPVFLPPL 132
            |::|:.||.:|:|:|..|..:||||.:||||||:|:|.|:: .::::|..:..||....:.:   
Human    62 LEETKEQILKLEEKLLALQEEKHQLFLQLKKVLHEEEKRRR-KEQSDLTTLTSAAYQQSLTV--- 122

  Fly   133 RLQHQHHTLMQKLPSGGQPGKRGRSPSPPSQQQA-------------YYKSAASYA-QQKHDDYR 183
                  ||....|...|.||...|..:..:..:|             |..|||::| ..:|    
Human   123 ------HTGTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEH---- 177

  Fly   184 RAADYARLSWNKTAAQYPGTGTVFYQTVAPPPTTQHQADARLQSIYNYNLPLRQAYHVDLPSATV 248
                          .|:.|:....|.|..|||              :|. |.:.||.   ||..:
Human   178 --------------GQFQGSPGGAYGTAQPPP--------------HYG-PTQPAYS---PSQQL 210

  Fly   249 SKPPDSQSPKAPSQSQPMQVLHINLDQPTISQADLVAQAGGSLSVKASQPHVTMEK-LPDRYHIE 312
            ..|....:.:..||.||.........|||  |...: |.||:||::....|...:. ..|...:.
Human   211 RAPSAFPAVQYLSQPQPQPYAVHGHFQPT--QTGFL-QPGGALSLQKQMEHANQQTGFSDSSSLR 272

  Fly   313 VKHDGQPPSHVPPPPHLLPEGVIFKPLLNELSLHSNVLQISSSQFPPQNPKTAGSITQGYAPGRG 377
            ..|    |..:.|.|.||                      :|.|.|.|.                
Human   273 PMH----PQALHPAPGLL----------------------ASPQLPVQM---------------- 295

  Fly   378 GSAHEQQLARQQLAMLPGQPGAPSG-SGSAQPPP 410
                              ||...|| :.::||.|
Human   296 ------------------QPAGKSGFAATSQPGP 311

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17002NP_610253.1 G_path_suppress 23..271 CDD:292610 71/269 (26%)
GPS2NP_004480.1 G_path_suppress 5..291 CDD:318248 94/369 (25%)
interaction with SUMO. {ECO:0000269|PubMed:20159957} 61..94 17/33 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C169978971
eggNOG 1 0.900 E1_298IM
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I5167
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007195
OrthoInspector 1 1.000 T1072915
orthoMCL 1 0.900 OOG5_134633
Panther 1 1.100 LDO PTHR22654
Phylome 1 0.910 0.875 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5091
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.