DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip42C.2 and IRT3

DIOPT Version :9

Sequence 1:NP_610231.2 Gene:Zip42C.2 / 35580 FlyBaseID:FBgn0033097 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_564766.1 Gene:IRT3 / 842387 AraportID:AT1G60960 Length:425 Species:Arabidopsis thaliana


Alignment Length:374 Identity:84/374 - (22%)
Similarity:139/374 - (37%) Gaps:102/374 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DQHLIVAKIVAIVVLFLVTLIFCFIPYLLDRFYKWTQRPENNAREFKVVLCLLNFGGGVLIATTF 67
            |....:.|.|||..:.|.......|| |:.|..::.|...|      :.:....|..||::||.|
plant    57 DSAAFLLKFVAIASILLAGAAGVTIP-LIGRNRRFLQTDGN------LFVTAKAFAAGVILATGF 114

  Fly    68 IHMLPEVVEVVNALQDCRMLAP-TPFGLPEVLLCTGFYLMYCIEETMHFV-------VRRRQQRK 124
            :|||....|.:.  ..|....| :.|..|      ||:.|.....|: ||       ..|:|:|:
plant   115 VHMLAGGTEALK--NPCLPDFPWSKFPFP------GFFAMIAALITL-FVDFMGTQYYERKQERE 170

  Fly   125 LREVVTIKDAGEELRTEIVVQ-------------PEES----------------PKEP------- 153
            ..|  :::..|.|....|||.             .|:|                ...|       
plant   171 ASE--SVEPFGREQSPGIVVPMIGEGTNDGKVFGEEDSGGIHIVGIHAHAAHHRHSHPPGHDSCE 233

  Fly   154 -------------------------------NWLRGLGIIVALSL----HELFGGMAIGLEMSVS 183
                                           |..|.:.:...|.|    |.:..|:::|:..|..
plant   234 GHSKIDIGHAHAHGHGHGHGHGHVHGGLDAVNGARHIVVSQVLELGIVSHSIIIGLSLGVSQSPC 298

  Fly   184 TVWFMTGAISVHKLVLAFCIGMEIMMAHTRWLLAVVYLLVFSIVTPIGVGIGIAVSESAAANQPS 248
            |:..:..|:|.|:....|.:|..|..|..|...|.:....|::.||||:|||.||:.|..::...
plant   299 TIRPLIAALSFHQFFEGFALGGCISQAQFRNKSATIMACFFALTTPIGIGIGTAVASSFNSHSVG 363

  Fly   249 TV--SGILQGLACGTLIYVVFFEIVAKNHAGIRILLS---SMVGFVLMF 292
            .:  .|||..|:.|.|:|:...:::|.:....::..:   .:|.:|::|
plant   364 ALVTEGILDSLSAGILVYMALVDLIAADFLSTKMRCNFRLQIVSYVMLF 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip42C.2NP_610231.2 Zip 9..294 CDD:280666 83/368 (23%)
IRT3NP_564766.1 zip 46..425 CDD:273287 84/374 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1558
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981397at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.