DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip42C.2 and ZIP12

DIOPT Version :9

Sequence 1:NP_610231.2 Gene:Zip42C.2 / 35580 FlyBaseID:FBgn0033097 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_201022.1 Gene:ZIP12 / 836336 AraportID:AT5G62160 Length:355 Species:Arabidopsis thaliana


Alignment Length:281 Identity:78/281 - (27%)
Similarity:119/281 - (42%) Gaps:61/281 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 FGGGVLIATTFIHMLPEVVEVVNALQDCRMLAPTP----FGLPEVLLCTGFYLMYCIEETMHFVV 117
            |..||::||.|:|:||:..|.:.:  .|  |...|    |.:..::......|...||......:
plant    85 FAAGVILATGFVHILPDATESLTS--SC--LGEEPPWGDFPMTGLVAMAASILTMLIESFASGYL 145

  Fly   118 RRRQQRKLREVVTIKDAGEE-------------------------------LRTEIVVQPEESPK 151
            .|.:..|..:.:.:...|||                               :|.:||.|..|   
plant   146 NRSRLAKEGKTLPVSTGGEEEHAHTGSAHTHASQGHSHGSLLIPQDDDHIDMRKKIVTQILE--- 207

  Fly   152 EPNWLRGLGIIVALSLHELFGGMAIGLEMSVSTVWFMTGAISVHKLVLAFCIGMEIMMAHTRWLL 216
                   |||:|    |.:..|:::|...||||:..:..||:.|:|...|.:|..|..|..|...
plant   208 -------LGIVV----HSVIIGISLGASPSVSTIKPLIAAITFHQLFEGFGLGGCISEAKFRVKK 261

  Fly   217 AVVYLLVFSIVTPIGVGIGIAVSESAAANQPST--VSGILQGLACGTLIYVVFFEIVA------K 273
            ..|.|:.|::..|||:||||.|:|....|.|..  |||.|...|.|.|||:...::||      |
plant   262 IWVMLMFFALTAPIGIGIGIGVAEIYNENSPMALKVSGFLNATASGILIYMALVDLVAPLFMNQK 326

  Fly   274 NHAGIRILLSSMVGFVLMFGL 294
            ..:.::|.::..|..|:..||
plant   327 TQSSMKIQVACSVSLVVGAGL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip42C.2NP_610231.2 Zip 9..294 CDD:280666 76/279 (27%)
ZIP12NP_201022.1 Zip 32..355 CDD:320972 78/281 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1558
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981397at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100840
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.