DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip42C.2 and LOC613053

DIOPT Version :9

Sequence 1:NP_610231.2 Gene:Zip42C.2 / 35580 FlyBaseID:FBgn0033097 Length:310 Species:Drosophila melanogaster
Sequence 2:XP_002939794.2 Gene:LOC613053 / 613053 -ID:- Length:303 Species:Xenopus tropicalis


Alignment Length:337 Identity:73/337 - (21%)
Similarity:129/337 - (38%) Gaps:110/337 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IVVLFLVTL---IFCFIPYLLDRFYKWTQRPENNAREFKVVLCLLNFGGGVLIATTFIHMLPEVV 75
            :||:||::|   :.||:..|:...:|.:::    ..:|..|     ||.|:|..|....::||.|
 Frog     4 LVVVFLISLAMFLGCFLLGLIPLAFKLSEQ----KLQFVSV-----FGAGLLCGTALAIIIPEGV 59

  Fly    76 EVV------------NALQDCRMLAPT------------PFGLPEVLLCTGFYLMYCIEETMHFV 116
            |::            |..|:...::.|            |.....|.|..||.||:.:::...:.
 Frog    60 ELLDGPGKEGPVICQNLTQNHTEISRTSEDAAEKSSSVPPHFFIGVSLVMGFILMFIVDQIGSYC 124

  Fly   117 VRRRQQRKLREVVTIKDAGEELRTEIVVQPEESPKEPNWLRGLGIIVALSLHELFGGMAIGL--- 178
                   ...:..|...||..:...                 ||:::    |....|:|:|.   
 Frog   125 -------SYHDPRTGMSAGTSITAT-----------------LGLVI----HAAADGVALGAAVA 161

  Fly   179 --EMSVSTVWFMTGAISVHKLVLAFCIGMEIMMAHTRWLLAVV--YLLVFSIVTP-IGVGIGIAV 238
              ::||..:.|.  |:.:||...||  |:...:.|.....|.:  :||.||:..| :.:...:.:
 Frog   162 SSQVSVQVIVFF--AVILHKAPAAF--GLVSFLMHAGLEKAQIRKHLLAFSLAAPLLTITTYLIL 222

  Fly   239 SESAAANQ---PSTVSGILQGLACGTLIYV----VFFEIVAKNH--------------------- 275
            |.:...:|   .:|.:|:|  .:.||.:||    |..||..:.|                     
 Frog   223 SLTGGTSQHRLTATGNGML--FSAGTFLYVATVHVLPEISGRGHHHHHVTSEYRHQGLGLLESVI 285

  Fly   276 ----AGIRILLS 283
                ||:.:|||
 Frog   286 LVVGAGLPLLLS 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip42C.2NP_610231.2 Zip 9..294 CDD:280666 73/337 (22%)
LOC613053XP_002939794.2 Zip 3..281 CDD:412377 68/319 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.