DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip42C.2 and slc39a1l

DIOPT Version :9

Sequence 1:NP_610231.2 Gene:Zip42C.2 / 35580 FlyBaseID:FBgn0033097 Length:310 Species:Drosophila melanogaster
Sequence 2:XP_012814441.1 Gene:slc39a1l / 548711 XenbaseID:XB-GENE-22062686 Length:315 Species:Xenopus tropicalis


Alignment Length:341 Identity:88/341 - (25%)
Similarity:158/341 - (46%) Gaps:79/341 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QHLIVAKIVAIVVLFLVTLIFCFIPYLLDRFYKWTQ----RPENNAREFKVVLCLLNFGGGVLIA 64
            ::|:..|:..:..|.|:||:|..:|..:..|.:..:    |||.:.|....:.||   .|||.:|
 Frog     2 EYLLQVKLGCLFGLLLLTLLFGLVPSRVKCFREGLERGECRPEAHQRWISFISCL---AGGVFLA 63

  Fly    65 TTFIHMLPEVV-----EVVNALQDCRMLAPTPFGLPEVLLCTGFYLMYCIEETMHFVVRRRQQRK 124
            ...:.::|:.:     |::|  |..:    |.|.|||.:|.|||.::..:|              
 Frog    64 ACLLDIIPDFLNDMKEEMIN--QQIK----TDFPLPEFILGTGFLIVLIVE-------------- 108

  Fly   125 LREVVTIKDAGEELRTEIVVQPEESP---KEPNW----------------------------LRG 158
             |.|:...:...|..|.::.....||   ::|:.                            .|.
 Frog   109 -RIVLDCSETMSEETTPLLSGGSNSPARQEQPHGHSHSHSGHHNDVEHRRHHFHVDFHAHSSFRS 172

  Fly   159 LGIIVALSLHELFGGMAIGLEMSVSTVWFMTGAISVHKLVLAFCIGMEIMMA--HTRWLLAVVYL 221
            ..::::||||.:|.|:||||:...|.|..:..||.:||.::|..:.:.::.:  .|||.  |:.:
 Frog   173 FILLLSLSLHSIFEGIAIGLQNVQSEVLQIAIAILIHKSIIAVSLSLLLLQSSVQTRWF--VLSI 235

  Fly   222 LVFSIVTPIGVGIGIAVSESAAANQPS---TVSGILQGLACGTLIYVVFFEIVA----KNHAGIR 279
            ::|::::|:|:||||.|..    ||..   .|..:|:|||.||.:|:.|.||:.    .|...:.
 Frog   236 VMFALMSPLGIGIGIGVMH----NQTDGNRMVQCVLEGLAAGTFVYITFLEILPHELNSNKWRLP 296

  Fly   280 ILLSSMVGFVLMFGLQ 295
            .::..::||..|..|:
 Frog   297 KVIFILLGFSGMAALR 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip42C.2NP_610231.2 Zip 9..294 CDD:280666 86/333 (26%)
slc39a1lXP_012814441.1 Zip 38..311 CDD:308248 78/302 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I4554
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D471714at33208
OrthoFinder 1 1.000 - - FOG0000574
OrthoInspector 1 1.000 - - mtm9523
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X561
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.