DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip42C.2 and Slc39a9

DIOPT Version :9

Sequence 1:NP_610231.2 Gene:Zip42C.2 / 35580 FlyBaseID:FBgn0033097 Length:310 Species:Drosophila melanogaster
Sequence 2:XP_006240345.1 Gene:Slc39a9 / 314275 RGDID:1311236 Length:308 Species:Rattus norvegicus


Alignment Length:353 Identity:65/353 - (18%)
Similarity:122/353 - (34%) Gaps:119/353 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VAIVVLFLVTLIFCFIPYLLDRFYKWTQRPENNAREFKVVLCLLNFGGGVLIATTFIHMLPEVVE 76
            ::|.:|.|..|:.|::..::.....:::      ...|:|..|   |.|:|..|....::||   
  Rat     5 LSISLLSLAMLVGCYVAGIIPLAVNFSE------ERLKLVTVL---GAGLLCGTALAVIVPE--- 57

  Fly    77 VVNALQDCRMLAPTPFGLPEVLLCTGFYLMYCIEETMHFVVRRRQQRKLREVVTIKDAGEELRTE 141
                                     |.:.:|  ||.:.  .:..|..:.::.|...|...|:  .
  Rat    58 -------------------------GVHALY--EEVLE--GKHHQASEAKQNVIASDKAAEI--S 91

  Fly   142 IVVQPEES------------------------------------------PKEPNWLRGLGIIVA 164
            :|.:.|.|                                          |........||::| 
  Rat    92 VVHEHEHSHDHTQLHAYIGVSLVLGFVFMLLVDQIGSSHVHSTDDPESARPSSSKITTTLGLVV- 155

  Fly   165 LSLHELFGGMAIGL-----EMSVSTVWFMTGAISVHKLVLAFCIGMEIMMAHTRWLLAVVYLLVF 224
               |....|:|:|.     :.||..:.|:  ||.:||...||.:...:|.|.........:||||
  Rat   156 ---HAAADGVALGAAASTSQTSVQLIVFV--AIMLHKAPAAFGLVSFLMHAGLERNRIRKHLLVF 215

  Fly   225 SIVTP---IGVGIGIAVSESAAANQPSTVSGILQGLACGTLIYV----VFFEIVAKNHA------ 276
            ::..|   :...:|::.|...|.::.: .:|:....:.||.:||    |..|:....|:      
  Rat   216 ALAAPAMSMLTYLGLSKSSKEALSEVN-ATGVAMLFSAGTFLYVATVHVLPEVGGMGHSHRPDTT 279

  Fly   277 ---GI------RILLSSMVGFVLMFGLQ 295
               |:      .::|..::..:|..|.|
  Rat   280 GGRGLSRLEVAALVLGCLIPLILSIGHQ 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip42C.2NP_610231.2 Zip 9..294 CDD:280666 63/350 (18%)
Slc39a9XP_006240345.1 Zip 9..302 CDD:280666 61/342 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.