DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip42C.2 and Slc39a12

DIOPT Version :9

Sequence 1:NP_610231.2 Gene:Zip42C.2 / 35580 FlyBaseID:FBgn0033097 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001012305.1 Gene:Slc39a12 / 277468 MGIID:2139274 Length:689 Species:Mus musculus


Alignment Length:312 Identity:57/312 - (18%)
Similarity:108/312 - (34%) Gaps:89/312 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LPEVVEVVNALQ---DC--RMLAPTPFGLPEVLL----CTGFYLMYCIEETMHFVVRRR------ 120
            ||::...:.||.   .|  |...|:|....|.:.    .|....:..||:.::.:..||      
Mouse   204 LPQLAATIIALSLQGVCLGRKALPSPDDFTEYIFSFLNSTNTLHLSEIEQLLNMLTTRRTCAKED 268

  Fly   121 ------QQRKLREVVTIKDAGEELRTEIVVQPEESPKEPNWLRGLGIIVALSLHELF----GGMA 175
                  |:::..|..:::|.    :|...:..|.....|:|  ......|..|.|:|    ..::
Mouse   269 KYLHQYQRKQNTEEHSLRDP----KTSTAMDKESDDHSPSW--DQACFSARQLVEIFLQNHSSLS 327

  Fly   176 IGLE------------------------------MSVSTVWFMTGAISVHKLVLAFCIGMEIMMA 210
            |..|                              .::....:.|.|:::  |.|...:|..:::.
Mouse   328 ISKEDFKQLSPGIIQQLLSCSCQMPKDQQAKPPPTTLEKYGYSTVAVTL--LTLGSMLGTALVLF 390

  Fly   211 HTRWLLAVVYLLVFSIVTPIGVG--------------IGIAVSESAAANQPSTVS------GILQ 255
            |:   ....|.|:..:...:.||              :|:...|:...:...:.|      |:|.
Mouse   391 HS---CEENYSLILQLFVGLAVGTLSGDALLHLIPQVLGLHKQEAEFGHFHESQSPIWKLLGLLG 452

  Fly   256 GLACGTLIYVVFFEIVAKNHAGIRILLSSMVGFVLMFGLQIAIGE--AKGKS 305
            |:....||...|..:|:.|..|:. |::..||.....||...:.:  :.|||
Mouse   453 GIHGFFLIEKCFILLVSPNTKGLP-LVNEHVGHTHHLGLNPELNDQSSGGKS 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip42C.2NP_610231.2 Zip 9..294 CDD:280666 52/297 (18%)
Slc39a12NP_001012305.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..303 5/31 (16%)
Zip 369..681 CDD:280666 30/141 (21%)
XEXPHE-motif. /evidence=ECO:0000250 578..583
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.