DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip42C.2 and zipt-9

DIOPT Version :9

Sequence 1:NP_610231.2 Gene:Zip42C.2 / 35580 FlyBaseID:FBgn0033097 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_506393.1 Gene:zipt-9 / 179862 WormBaseID:WBGene00011329 Length:381 Species:Caenorhabditis elegans


Alignment Length:179 Identity:37/179 - (20%)
Similarity:70/179 - (39%) Gaps:37/179 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LCTGFYLMYCIEETMHFVVRRRQQRKLREVVTIKDAGEELRTEIVVQPEESPKEPNWLRGLGIIV 163
            |..||.||..:::.....|.|..:           ||   |:.|               |:...:
 Worm   177 LVLGFVLMLLVDQIGSVTVARNDR-----------AG---RSRI---------------GISATI 212

  Fly   164 ALSLHELFGGMAIGL-----EMSVSTVWFMTGAISVHKLVLAFCIGMEIMMAHTRWLLAVVYLLV 223
            .|.:|....|:|:|.     :..|..:.|:  ||.:||...||.:...::|..........:|:|
 Worm   213 GLVVHAAADGVALGSASVINKSDVQIIVFV--AIMLHKAPAAFGLVSFLLMESIDRRAIRKHLVV 275

  Fly   224 FSIVTPIGVGIG-IAVSESAAANQPSTVSGILQGLACGTLIYVVFFEIV 271
            ||...|:...:. :.:.:...:.:..:.:|:|...:.||.:||....::
 Worm   276 FSAAAPLAALVTFVLIMQMGESMRSESSTGVLMLFSAGTFLYVATVHVL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip42C.2NP_610231.2 Zip 9..294 CDD:280666 37/179 (21%)
zipt-9NP_506393.1 Zip 4..376 CDD:280666 37/179 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.