DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip42C.2 and AgaP_AGAP005405

DIOPT Version :9

Sequence 1:NP_610231.2 Gene:Zip42C.2 / 35580 FlyBaseID:FBgn0033097 Length:310 Species:Drosophila melanogaster
Sequence 2:XP_315414.4 Gene:AgaP_AGAP005405 / 1276105 VectorBaseID:AGAP005405 Length:823 Species:Anopheles gambiae


Alignment Length:190 Identity:47/190 - (24%)
Similarity:74/190 - (38%) Gaps:33/190 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LREVVTIKDAGEELRTEIVVQPEESPKEPNWLRGLGIIVALSLHELFGGMAIGLEMSVSTVWFMT 189
            |||..| |..|.......|..|..|.....|:    :::...||....||.||...:.:.....:
Mosquito   638 LREHET-KHHGHSHTHGHVHSPPGSLSAVAWM----VVMGDGLHNFTDGMTIGAAFANNIAGGFS 697

  Fly   190 GAISVHKLVLAFCIGMEIMMAHTRWLL--------AVVYLLVFSIVTPIGVGIGIAVSESAAANQ 246
            .||:|      ||..:...:.....||        ||.|.|:.|:::.:|:.:||.|     .:|
Mosquito   698 TAIAV------FCHELPHELGDFAVLLKAGMSAREAVYYNLLSSLLSLLGMVLGIIV-----GHQ 751

  Fly   247 PSTVSGILQGLACGTLIYVVFF----EIVAKNHAGIRILLSSMV----GFVLMFGLQIAI 298
            |...|.:. .:|.|..:|:...    |:.:.:.|..|...|..|    |..|.|.:.:.|
Mosquito   752 PEASSWVF-AVAAGMFLYIALVDMIPELTSSHGAEERCKTSEFVLQFLGLTLGFSIMMVI 810

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip42C.2NP_610231.2 Zip 9..294 CDD:280666 46/184 (25%)
AgaP_AGAP005405XP_315414.4 Zip 370..811 CDD:280666 47/190 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.