| Sequence 1: | NP_610231.2 | Gene: | Zip42C.2 / 35580 | FlyBaseID: | FBgn0033097 | Length: | 310 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_002934324.1 | Gene: | slc39a2 / 100496006 | XenbaseID: | XB-GENE-965557 | Length: | 306 | Species: | Xenopus tropicalis | 
| Alignment Length: | 313 | Identity: | 82/313 - (26%) | 
|---|---|---|---|
| Similarity: | 150/313 - (47%) | Gaps: | 40/313 - (12%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     4 QHLIVAKIVAIVVLFLVTLIFCFIPYLLDRFYKWTQRPENNAREFKVVLCLL-NFGGGVLIATTF 67 
  Fly    68 IHMLPEVVEVVNALQDCRMLAPTPFGLPEVLLCTGFYLMYCIEE-TMHFVVRRR-QQRKLREVVT 130 
  Fly   131 IKDAGEELRTEIVVQPEESPKEPN------------------WLRGLGIIVALSLHELFGGMAIG 177 
  Fly   178 LEMSVSTVWFMTGAISVHKLVLAFCIGMEIMMAHTRWLLAVVYLLVFSIVTPIGVGIGIAVSESA 242 
  Fly   243 AANQPSTVSGILQGLACGTLIYVVFFEIVAKN----HAGIRILLSSMVGFVLM 291 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Zip42C.2 | NP_610231.2 | Zip | 9..294 | CDD:280666 | 81/308 (26%) | 
| slc39a2 | XP_002934324.1 | Zip | 7..303 | CDD:308248 | 81/308 (26%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 125 | 1.000 | Inparanoid score | I4554 | 
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D471714at33208 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0000574 | |
| OrthoInspector | 1 | 1.000 | - | - | mtm9523 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X561 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 5.060 | |||||