DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chk and ATG22

DIOPT Version :9

Sequence 1:NP_001163063.1 Gene:chk / 35578 FlyBaseID:FBgn0033095 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_009892.1 Gene:ATG22 / 850319 SGDID:S000000543 Length:528 Species:Saccharomyces cerevisiae


Alignment Length:197 Identity:46/197 - (23%)
Similarity:72/197 - (36%) Gaps:69/197 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 YGWVVVFAS---------LVVSLIA-----DGLS--------FS--------FGLINVELLEYFG 171
            ||||.:|.|         :::.|||     |.::        ||        ..||.:.:|....
Yeast   301 YGWVSLFESFKHARLLKDVMIFLIAWFIISDSITTINSTAVLFSKAELHMSTLNLIMISVLTVVN 365

  Fly   172 ES----------TSKTAWISS--LFFSVPLLMGPIWSNLVDKYGCRKMTILGGVVSAFGFALSSF 224
            ..          .:|..|.||  |.:.:      ||::.:..||     |||...:|||..    
Yeast   366 AMLGAFMIPQFLATKFRWTSSQTLMYII------IWASFIPFYG-----ILGFFFNAFGLK---- 415

  Fly   225 CNSIEMLMVTFGIISGLGLGIGYVTAVVSIAFWF----DKKRTFATGIGASGTG---IGTFVYAR 282
             :..||.::..    ..||.:|.::||....|..    .|:.||.:....:..|   :|.|:...
Yeast   416 -HKFEMFLLAI----WYGLSLGGLSAVSRSVFSLIVPPGKESTFFSMFSITDKGSSILGPFLVGL 475

  Fly   283 LT 284
            ||
Yeast   476 LT 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chkNP_001163063.1 MFS 143..>315 CDD:119392 42/191 (22%)
MFS <685..869 CDD:119392
ATG22NP_009892.1 MFS_Atg22_like 28..484 CDD:341036 46/197 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11360
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.