DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chk and AT5G14120

DIOPT Version :9

Sequence 1:NP_001163063.1 Gene:chk / 35578 FlyBaseID:FBgn0033095 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_196916.1 Gene:AT5G14120 / 831262 AraportID:AT5G14120 Length:579 Species:Arabidopsis thaliana


Alignment Length:340 Identity:74/340 - (21%)
Similarity:121/340 - (35%) Gaps:95/340 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 WVVVFASLVVSLIADGLSFSFGLINVEL---LEYFGESTSKTAWISSLFFSVPLLMG------PI 194
            |:|..|::.:...| |:.:.||.|:..:   |.|..:..|:......|..||..:.|      |:
plant    17 WLVFVAAMWIQSCA-GIGYLFGSISPVIKSSLNYNQKELSRLGVAKDLGDSVGFIAGTLSEILPL 80

  Fly   195 WSNLVDKYGCRKMTILGGVVSAFGFA--------------LSSFC------NSIEMLMVTFGIIS 239
            |:.|          ::|.|.:..|:.              |.:.|      |:.|....|..::|
plant    81 WAAL----------LVGAVQNLIGYGWVWLIVTGRAPILPLWAMCVLIFVGNNGETYFNTGALVS 135

  Fly   240 GLGLGIGYVTAVVSIAFWFDKKRTFATGIGASGTGIGTFVYARLTSYLIESYGWRGATLILGGTM 304
            |:..              |.|.|....||.....|:|..:.:::.:.:..|   ..|:|||...:
plant   136 GVQN--------------FPKSRGPVVGILKGFAGLGGAIISQIYTMIHSS---NPASLILMVAV 183

  Fly   305 LNACVCGALMRDPDWLIE----ENRLESRSQSVTTFSNSSVCLEEIKKLLDTGITKEAVLDS--- 362
            ..|.|...||    :.|.    ..::.....:..||. ..|||.....|:...:.::.|:.|   
plant   184 TPAVVVVCLM----FFIRPVGGHKQIRPTDGASFTFI-YGVCLLLAAYLMSVMLIQDLVVVSHNV 243

  Fly   363 -------------------LVTKNNTEANQQIDDPLDSAL--KRYRSEIFLPT---FLSTQELDS 403
                               ::|...||.|:. ||.::..|  ||...|..|.|   .||..|.:.
plant   244 ITVFTIVLFVILVVPILVPIMTSFFTETNEP-DDTIEEPLVPKREDQEPGLQTPDLILSEVEDEK 307

  Fly   404 ICEVKSLSRRSLRHK 418
            ..:| .|...|.|||
plant   308 PKDV-DLLPASERHK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chkNP_001163063.1 MFS 143..>315 CDD:119392 41/200 (21%)
MFS <685..869 CDD:119392
AT5G14120NP_196916.1 MFS_Mch1p_like 16..556 CDD:340912 74/340 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I4618
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.