DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab2 and Rab37

DIOPT Version :10

Sequence 1:NP_477090.1 Gene:Rab2 / 35577 FlyBaseID:FBgn0014009 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_067386.3 Gene:Rab37 / 58222 MGIID:1929945 Length:223 Species:Mus musculus


Alignment Length:167 Identity:80/167 - (47%)
Similarity:121/167 - (72%) Gaps:1/167 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SYAYLFKYIIIGDTGVGKSCLLLQFTDKRF-QPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQ 65
            :|....|.:::||:||||:|.|:||.|..| ......|:|::|..:::|:||.::||||||||||
Mouse    25 NYDLTGKVMLLGDSGVGKTCFLIQFKDGAFLSGTFIATVGIDFRNKVVTVDGARVKLQIWDTAGQ 89

  Fly    66 EAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVK 130
            |.|||:|.:|||.|...||:||||.:.:|:::..||.:..:::..::||||:|||:|:.|.|.::
Mouse    90 ERFRSVTHAYYRDAQALLLLYDITNQSSFDNIRAWLTEIHEYAQRDVVIMLLGNKADVSSERVIR 154

  Fly   131 KEEGEAFAREHGLVFMETSARTAANVEEAFINTAKEI 167
            .|:||..|||:|:.||||||:|..|||.||:..|||:
Mouse   155 SEDGETLAREYGVPFMETSAKTGMNVELAFLAIAKEL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab2NP_477090.1 PLN03108 1..213 CDD:178655 80/167 (48%)
Rab37NP_067386.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Rab26 31..220 CDD:206695 79/161 (49%)
Switch 1. /evidence=ECO:0000250|UniProtKB:P62820 52..67 3/14 (21%)
Switch 2. /evidence=ECO:0000250|UniProtKB:P62820 85..102 12/16 (75%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.