DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PGAP3 and AT1G16560

Sequence 1:NP_610223.1 Gene:PGAP3 FlyBaseID:FBgn0033088 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001319020.1 Gene:AT1G16560 AraportID:AT1G16560 Length:342 Species:Arabidopsis thaliana

Alignment Length:346 Identity:115/347 (33%)
Similarity:174/347 (50%) Gaps:40/347 (12%)


  Fly     7 SAIVLLLGALVTACLASNGDRTQFFHNCRQNCERTNC-----------SADGLEIQEQAVKFYQQ 60
            :|:.|||..|.....||.||....:..|...||.:.|           |:||      ...:.|:
plant     7 TALFLLLPCLFCISNASAGDADPDYRTCVSECEISGCVGQLCFPQCNSSSDG------GPWYIQE 65

  Fly    61 SVFDRLFQWSCADECQYGCMWRTVFAFFER---GWPIPQFYGKWPFLRLLGMQEPASVIFSCLNF 122
            .::.:..:|.|..:|:|.||   |....||   |....:::|||||.|:||:||||||.||.||.
plant    66 PLYLQWKKWGCQGDCRYQCM---VNRETERETLGQAPVKYHGKWPFKRVLGIQEPASVAFSVLNL 127

  Fly   123 VVHLR------LLRKFRREVRPDSPCYM----LTHIFAVTSLNGWIWSAIFHTRDFPLTELLDYA 177
            .:|..      ::..::..::.|...|.    |.||:.:.|:|.|.|||:||:||..|||.|||:
plant   128 AMHFHGWLSFFIMIYYKLPLKQDRTAYYEYVGLWHIYGLLSMNSWFWSAVFHSRDVDLTERLDYS 192

  Fly   178 FAYSIILCSLYVMVMRMLHRYSLFLRGVITLAFLSYYINYFAYLSVGRFNYAFNMMVNVATGVIA 242
            .|.:|:..||.:.::|.........|.:::...|::...:..|::..:.:|.:||:|.||.||..
plant   193 SAVAILGFSLILAILRTFDIRVEAARVMVSAPILAFVTTHILYINFYKLDYGWNMIVCVAMGVSQ 257

  Fly   243 AVGWFVWCHFVRTRRPYFRRILRFYILMALAMSLELLDFPPILWILDAHALWHLATIPLASLYYD 307
            ...|..|.  ..:..|...::....|...|||.||:.||||.....|||::||.|||||..|::.
plant   258 LFLWARWA--AVSSHPSNWKLWVVVIAGGLAMLLEIYDFPPYEGYFDAHSIWHAATIPLTILWWS 320

  Fly   308 FMIEDC--RT---LRKEKAAA 323
            |:.:|.  ||   |:|.|..|
plant   321 FIRDDAEFRTSSLLKKTKTKA 341

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PGAP3NP_610223.1 Per1 65..313 CDD:282000 92/261 (35%)
AT1G16560NP_001319020.1 Per1 66..326 CDD:282000 92/265 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H5484
Inparanoid 1 1.050 171 1.000 Inparanoid score I1494
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T124450
orthoMCL 1 0.900 OOG5_129324
Panther 1 1.100 LDO PTHR13148
Phylome 1 0.910 0.667 Consistency score
87.970

Return to query results.
Submit another query.