DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15233 and CG31128

Sequence 1:NP_610214.2 Gene:CG15233 FlyBaseID:FBgn0033076 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_733000.1 Gene:CG31128 FlyBaseID:FBgn0051128 Length:166 Species:Drosophila melanogaster

Alignment Length:168 Identity:43/169 (25%)
Similarity:70/169 (41%) Gaps:35/169 (21%)


  Fly     4 GALNTLAIVLLLMPGTFCQCIDCNAHWKFHCKTNLTGFYCAPGA------YVHQWVVPEEDYHSD 62
            |||..|....:..|    .|.:||...: .|..:.:|.:|....      :.|.  :.|:.|:.|
  Fly    22 GALKDLKEGKIAEP----LCSNCNKIQR-KCTVSHSGLFCKNKTDKEKILFSHS--LAEKLYNLD 79

  Fly    63 LKGFNTPFSACTPFPLEIS-YIETFCCLYSPSIGC-QLALNPGIFNKEKLPVR-RCKDCIEHCQC 124
                     .|.|....:: .|..:|||:||.:|| |||   ||:.:.:...| .|:.|:..|.|
  Fly    80 ---------ECVPHKYNVTGPILDWCCLWSPKLGCQQLA---GIYYQNQSRWRDTCEICLHSCIC 132

  Fly   125 SNKSTPPLK--PRM-VVSLLGMFAMLTESIYLTQKVWA 159
            ...:...:|  |.. .::.||:..:|....||    |:
  Fly   133 DEDTNGVVKCSPTAGCLAALGILGILLSRSYL----WS 166



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133399659
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.