DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pld and Pld6

DIOPT Version :10

Sequence 1:NP_001137610.1 Gene:Pld / 35554 FlyBaseID:FBgn0286511 Length:1364 Species:Drosophila melanogaster
Sequence 2:NP_001277212.1 Gene:Pld6 / 194908 MGIID:2687283 Length:221 Species:Mus musculus


Alignment Length:109 Identity:29/109 - (26%)
Similarity:50/109 - (45%) Gaps:29/109 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1121 GIAVRAITHWNYASISRGRTSILTRLQEAGIANPENYISFHSLRNHSFLNNTPITELIYVHSKLL 1185
            |:.||.||..:|.:::..:..:   |::|||          .:|:..        :|.|:|.|..
Mouse   114 GVRVRVITDCDYMALNGSQIGL---LRKAGI----------QVRHDQ--------DLGYMHHKFA 157

  Fly  1186 IADDRVVICGSANINDRSMIGKR-------DSEIAAILMDEEFE 1222
            |.|.:|:|.||.|...:::...|       |:|...:.: ||||
Mouse   158 IVDKKVLITGSLNWTTQAIQNNRENVLIMEDTEYVRLFL-EEFE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PldNP_001137610.1 PX_PLD 230..431 CDD:132805
PLN02866 388..1349 CDD:215467 29/109 (27%)
Pld6NP_001277212.1 Required for mitochondrial localization 1..38
PLDc_vPLD6_like 92..203 CDD:197268 29/109 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.