DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and Sry-beta

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster


Alignment Length:366 Identity:87/366 - (23%)
Similarity:132/366 - (36%) Gaps:94/366 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RLEHGDNLTDVICDLCLRRLHDARDFQRRCEHSEQVLRMRHEHWKHTVAVGDALALDDVLECLER 109
            |||...|  ...|..||..|.   ::.|...:..||.|.          :.|||     |.|  |
  Fly    49 RLELLPN--SAACRDCLEYLF---NYDRLVRNLSQVQRQ----------IADAL-----LGC--R 91

  Fly   110 EVGSLEGPMSVPLQASKPVAHVAPLMETVDFESLDFQDSSHSEHDIPSYWESSVDSGSLNTPHHQ 174
            :|   ||......||:|                       .:...:|::  ..|.:.:|..|..|
  Fly    92 QV---EGKAETKQQAAK-----------------------RARVQVPAF--KIVQATALKEPERQ 128

  Fly   175 P----ETAEL-----------FAVEPPTPPESSEEPAPDAAEKP-----------KMRRARPRQD 213
            |    |..|.           |:....:.|.|.||...:..|.|           ::.....:.|
  Fly   129 PGEEDECEEFMKEEMLDEEFQFSEPDDSMPSSEEEFFTETTEIPCHICGEMFSSQEVLERHIKAD 193

  Fly   214 NVKPKERKASGAVHPRSLHPCPECEKKFTRNFQLKLHMTAVHGMGEMRYQCEECRKNFASRHSLR 278
            ..:..|:..           |..|..|...:..|.|||....|..|:  :|..|.|.|:.:.::.
  Fly   194 TCQKSEQAT-----------CNVCGLKVKDDEVLDLHMNLHEGKTEL--ECRYCDKKFSHKRNVL 245

  Fly   279 YHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPTKSDLRTHMRS 343
            .|:: ||..::.:.|..|..||.|...:.:||..|..|....|  |:.|.:.:.||...:.|:|:
  Fly   246 RHME-VHWDKKKYQCDKCGERFSLSWLMYNHLMRHDAEENALI--CEVCHQQFKTKRTYKHHLRT 307

  Fly   344 HNPNMERPFKCDRCSKAFFTRGHLNSHLLVHTG-EKPFACE 383
            |..:..| :.|..|.|:|..:..|..|..||.. |||.:.|
  Fly   308 HQTDRPR-YPCPDCEKSFVDKYTLKVHKRVHQPVEKPESAE 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 11/36 (31%)
C2H2 Zn finger 234..255 CDD:275368 7/20 (35%)
C2H2 Zn finger 264..285 CDD:275368 5/20 (25%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)
zf-C2H2_8 305..373 CDD:292531 19/67 (28%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..374 CDD:275368 6/19 (32%)
zf-H2C2_2 366..389 CDD:290200 8/19 (42%)
C2H2 Zn finger 382..403 CDD:275368 1/2 (50%)
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 7/19 (37%)
C2H2 Zn finger 231..251 CDD:275368 5/20 (25%)
C2H2 Zn finger 259..308 CDD:275368 16/50 (32%)
C2H2 Zn finger 288..303 CDD:275370 4/14 (29%)
zf-C2H2 315..337 CDD:278523 6/21 (29%)
C2H2 Zn finger 317..337 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446672
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.