DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and CG31365

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster


Alignment Length:631 Identity:115/631 - (18%)
Similarity:204/631 - (32%) Gaps:249/631 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PHHP---LVCRCCLLEQPPLYHSLYDASSQLAVELKALA-PALRLEHGDNLTDVICDLCLRRLHD 66
            |.:|   .:||.||.|....|....:..:||::.::.:| .||..:..|.|...||..|..:|..
  Fly     5 PSYPDLATLCRLCLKEHQDAYAIFDEDDTQLSIPVRLMACVALDAKATDTLPKRICQECRYQLEK 69

  Fly    67 ARDFQRRCEHSEQVLR--------------------------------------------MRHEH 87
            :..|::||:.:|:.||                                            :..|.
  Fly    70 SFLFRQRCQWAEKKLRKHIRLLGLGKRSRVFSKDPDDYDEDELEFEDSIAFIEVQDKVRKLEDEK 134

  Fly    88 WK-----------HTVAVGDALAL-----------------DDVLECLEREVGS-----LEGPMS 119
            |:           |...|...|.|                 .:|.:.|..||.|     |...:|
  Fly   135 WREDFKEEQAAEMHKRLVKSRLELRAKLTTELRKELAEEVRSEVRKELAEEVRSQVRDDLRNEVS 199

  Fly   120 VPLQASKPVAHVAPLMETVD----------FESLD----------FQDSSHS------------- 151
            ..::..:    :|.|:..::          :||||          .:|:|.|             
  Fly   200 EDIRKEQ----LAMLLGELEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPS 260

  Fly   152 -----------------------------------------EHDIPSYWESSVDSGSLN-----T 170
                                                     :.::|:  ||..|...:|     .
  Fly   261 LVDANLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPA--ESGEDFREINMVGSDV 323

  Fly   171 PHHQPETAELFAVEPPTPPESSEEPAPD--------------------AAEKPK----------- 204
            .|  .:..|::.:...:..:.:::..|:                    :.|||:           
  Fly   324 VH--TDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLG 386

  Fly   205 ------------------MRRARPRQDNVKPKERKASGAVHPRSLHPCPE--------------- 236
                              :.:.:..:|...|.:||.|..:..:....||:               
  Fly   387 EEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQC 451

  Fly   237 --CEKKF-TRNFQLKLHMTAVHGM-----GEMRYQCEECRKNFASRHSLRYHVKSVHSTERPFGC 293
              |...| |:....:.|.|.:.|:     |.::  |..|....:...||:.|: .:|:..:||.|
  Fly   452 HLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLK--CPSCALQLSCASSLKRHM-IIHTGLKPFKC 513

  Fly   294 QHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPTKSDLRTHM-RSHNPNMERPFKCDRC 357
            ..|:..|..|..|..|:.||||..:   .:|.:||..:..||:|:.|: |.|..| .|..||..|
  Fly   514 SECELSFSQREVLKRHMDTHTGVKR---HQCPQCSSCFAQKSNLQQHIGRVHMGN-SRTHKCHLC 574

  Fly   358 SKAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNHMVRLH 403
            .::|.....|:.||:.|.|.. |:|:.|.:.:.....:..|:..:|
  Fly   575 HRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTTMH 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 21/71 (30%)
C2H2 Zn finger 234..255 CDD:275368 7/38 (18%)
C2H2 Zn finger 264..285 CDD:275368 5/20 (25%)
C2H2 Zn finger 293..313 CDD:275368 6/19 (32%)
zf-C2H2_8 305..373 CDD:292531 24/68 (35%)
C2H2 Zn finger 324..344 CDD:275368 8/20 (40%)
C2H2 Zn finger 354..374 CDD:275368 6/19 (32%)
zf-H2C2_2 366..389 CDD:290200 8/22 (36%)
C2H2 Zn finger 382..403 CDD:275368 3/20 (15%)
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 22/72 (31%)
vATP-synt_E 109..>244 CDD:304907 19/138 (14%)
RRF <161..222 CDD:294170 9/64 (14%)
zf-C2H2_8 454..530 CDD:292531 20/78 (26%)
C2H2 Zn finger 485..505 CDD:275368 5/20 (25%)
zf-H2C2_2 497..522 CDD:290200 9/25 (36%)
C2H2 Zn finger 513..533 CDD:275368 6/19 (32%)
zf-H2C2_2 526..550 CDD:290200 9/26 (35%)
C2H2 Zn finger 541..562 CDD:275368 8/20 (40%)
C2H2 Zn finger 571..591 CDD:275368 6/19 (32%)
C2H2 Zn finger 598..617 CDD:275368 3/18 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453401
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005215
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.