Sequence 1: | NP_610211.1 | Gene: | CG30431 / 35549 | FlyBaseID: | FBgn0050431 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_732827.1 | Gene: | CG31365 / 42736 | FlyBaseID: | FBgn0051365 | Length: | 639 | Species: | Drosophila melanogaster |
Alignment Length: | 631 | Identity: | 115/631 - (18%) |
---|---|---|---|
Similarity: | 204/631 - (32%) | Gaps: | 249/631 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 PHHP---LVCRCCLLEQPPLYHSLYDASSQLAVELKALA-PALRLEHGDNLTDVICDLCLRRLHD 66
Fly 67 ARDFQRRCEHSEQVLR--------------------------------------------MRHEH 87
Fly 88 WK-----------HTVAVGDALAL-----------------DDVLECLEREVGS-----LEGPMS 119
Fly 120 VPLQASKPVAHVAPLMETVD----------FESLD----------FQDSSHS------------- 151
Fly 152 -----------------------------------------EHDIPSYWESSVDSGSLN-----T 170
Fly 171 PHHQPETAELFAVEPPTPPESSEEPAPD--------------------AAEKPK----------- 204
Fly 205 ------------------MRRARPRQDNVKPKERKASGAVHPRSLHPCPE--------------- 236
Fly 237 --CEKKF-TRNFQLKLHMTAVHGM-----GEMRYQCEECRKNFASRHSLRYHVKSVHSTERPFGC 293
Fly 294 QHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPTKSDLRTHM-RSHNPNMERPFKCDRC 357
Fly 358 SKAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNHMVRLH 403 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30431 | NP_610211.1 | zf-AD | 11..82 | CDD:285071 | 21/71 (30%) |
C2H2 Zn finger | 234..255 | CDD:275368 | 7/38 (18%) | ||
C2H2 Zn finger | 264..285 | CDD:275368 | 5/20 (25%) | ||
C2H2 Zn finger | 293..313 | CDD:275368 | 6/19 (32%) | ||
zf-C2H2_8 | 305..373 | CDD:292531 | 24/68 (35%) | ||
C2H2 Zn finger | 324..344 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 354..374 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 366..389 | CDD:290200 | 8/22 (36%) | ||
C2H2 Zn finger | 382..403 | CDD:275368 | 3/20 (15%) | ||
CG31365 | NP_732827.1 | zf-AD | 13..86 | CDD:214871 | 22/72 (31%) |
vATP-synt_E | 109..>244 | CDD:304907 | 19/138 (14%) | ||
RRF | <161..222 | CDD:294170 | 9/64 (14%) | ||
zf-C2H2_8 | 454..530 | CDD:292531 | 20/78 (26%) | ||
C2H2 Zn finger | 485..505 | CDD:275368 | 5/20 (25%) | ||
zf-H2C2_2 | 497..522 | CDD:290200 | 9/25 (36%) | ||
C2H2 Zn finger | 513..533 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 526..550 | CDD:290200 | 9/26 (35%) | ||
C2H2 Zn finger | 541..562 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 571..591 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 598..617 | CDD:275368 | 3/18 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45453401 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0005215 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.930 |