DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30431 and CG4424

Sequence 1:NP_610211.1 Gene:CG30431 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_650859.3 Gene:CG4424 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster

Alignment Length:411 Identity:104/412 (25%)
Similarity:149/412 (36%) Gaps:124/412 (30%)


  Fly    11 VCRCCLL--------------EQPPLYHSLYDASSQLA-VELKALAPALRLEHGDNLTDVICDLC 60
            :||.||.              ::.|...||.|....|: ::::|.|..      :.|...||..|
  Fly    10 LCRTCLQDGEAHMVSIFQTADDRLPGGVSLCDKIESLSGIQIRATAKE------EVLPTRICLRC 68

  Fly    61 LRRLHDARDFQRRCEHSEQVLRMRHEHWKHTVAVGDALALDDVLECLEREVGSLEGPMSVPLQAS 125
            ...|..|..|::.|:.|.:.||              ...:.|.:|         :|.:...:|.:
  Fly    69 KAFLTLAHKFRQICQRSNEFLR--------------EYVIKDAVE---------QGVVKEVVQQT 110

  Fly   126 KPVAHVAPLMETVDFESLDFQDSSHSEHDIPSYWESSVDSGSLNTPHHQPE-------TAELFAV 183
            :|  ...|.:||   |.|:..:....|..:   |  |.:.....|||...|       |.|:...
  Fly   111 RP--STPPPIET---EQLEPPEDEVLEEGV---W--STEDPIEETPHGPAEKERPTVLTVEMLPA 165

  Fly   184 EPPTPPESSEEPAPDAAEKPKMRRARPRQDNVKPKERKASGAVHPRSLHPCPECEKKFTRNFQLK 248
             |..||.|:..|||..|.|.|                          ||.|..|...:.|...|.
  Fly   166 -PYPPPASTPPPAPAGAVKGK--------------------------LHVCAICGNGYPRKSTLD 203

  Fly   249 LHMTAVHGMGEMRYQCEECRKNFASRHSLRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTH 313
            .||.. |. .|..|:||.|.|:|...:.|:.|::. |:..:|:.||:|.|.|..||.|:.|.|||
  Fly   204 THMRR-HN-DERPYECEICHKSFHVNYQLKRHIRQ-HTGAKPYTCQYCQRNFADRTSLVKHERTH 265

  Fly   314 TGEAKPRIFECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGEK 378
            ..                                 |||:.|..|.|.|.....|..|...|||||
  Fly   266 RN---------------------------------ERPYACKTCGKKFTYASVLKMHYKTHTGEK 297

  Fly   379 PFACEYCDKCYQSVGNLNNHM 399
            |..|:.|:|.:..:.||..|:
  Fly   298 PHICQLCNKSFARIHNLVAHL 318

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 21/86 (24%)
C2H2 Zn finger 234..255 CDD:275368 6/21 (29%)
C2H2 Zn finger 264..285 CDD:275368 7/21 (33%)
C2H2 Zn finger 293..313 CDD:275368 11/20 (55%)
zf-C2H2_8 305..373 CDD:292531 14/68 (21%)
C2H2 Zn finger 324..344 CDD:275368 0/20 (0%)
C2H2 Zn finger 354..374 CDD:275368 6/20 (30%)
zf-H2C2_2 366..389 CDD:290200 11/23 (48%)
C2H2 Zn finger 382..403 CDD:275368 6/19 (32%)
CG4424NP_650859.3 zf-AD 10..92 CDD:285071 22/102 (22%)
C2H2 Zn finger 189..209 CDD:275368 6/21 (29%)
DUF45 <204..281 CDD:302795 33/113 (29%)
COG5048 210..>345 CDD:227381 44/145 (30%)
C2H2 Zn finger 217..237 CDD:275368 7/21 (33%)
C2H2 Zn finger 245..265 CDD:275368 11/20 (55%)
zf-H2C2_2 257..282 CDD:290200 12/58 (21%)
C2H2 Zn finger 273..293 CDD:275368 6/20 (30%)
zf-H2C2_2 286..310 CDD:290200 11/24 (46%)
C2H2 Zn finger 301..320 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24409
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.