DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30431 and CG8301

Sequence 1:NP_610211.1 Gene:CG30431 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_649915.1 Gene:CG8301 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster

Alignment Length:428 Identity:104/429 (24%)
Similarity:173/429 (40%) Gaps:67/429 (16%)


  Fly    12 CRCCLLEQ--------------PPLYHSLYDASSQLAVELKALAPALRLEHGDNLTDVICDLCLR 62
            ||.|.:..              ..|:|.....|....:.|:.....|::...|.|...||..|..
  Fly     4 CRTCAISMFVCDFENGSNNSHFLDLHHPNCWPSEMAQIRLQFANWNLKISPNDGLPQKICSDCFT 68

  Fly    63 RLHDARDFQRRCEHSEQVLRMRHEHWKHTVAVGDALALDDVLECLEREVG--SLE-GPMSVPLQA 124
            :......|:..|:.::  |::.|.:.|.     ||.:|:|      .|:|  .|| .......:.
  Fly    69 KFCSINAFRLACQEAQ--LKLSHIYDKI-----DASSLED------DEIGQEDLEPAEEHQETET 120

  Fly   125 SKPVAHVAPLMETVDFESLDFQDSSHSEHDIPSYWESSVDSGSLNTPHHQPETAELFAVEPPTPP 189
            :||...|          |.:.|.::.:...|    |..||:..::....:.|..|    :.....
  Fly   121 TKPTTTV----------SAETQPNNTASDPI----EIFVDAVDIDEAEEEEEEEE----QQQQYD 167

  Fly   190 ESSEEPAPDAAEKPKMRRARPRQDNVKPKER--------KASGAVH-PRSLHPCPECEKKFTRNF 245
            |..|||..|.:..|::..:...:..::|:|.        :...|.| |...:.|||||.:|....
  Fly   168 EEVEEPITDESAPPQLTISYACKFCLRPQENYQLQQLLLEHINASHDPEQPYNCPECEARFQDAA 232

  Fly   246 QLKLHMTAVHGMGEMRYQCEECRKNFASRHSLRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHL 310
            ...:|:.:.|  .|.::.|..|.|.:..||:||:||:..|| |..|.|..|::||..|..|..|:
  Fly   233 SRTVHLKSSH--VEKQHACGVCGKKYGDRHNLRHHVEKYHS-ETDFECALCEKRFYTRKSLNYHM 294

  Fly   311 RTHTGEAKPRIFECQR--CSKSWPTKSDLRTHMRSHNPNMERPFK-CDRCSKAFFTRGHLNSHLL 372
            :.|..:   |.|:|:.  |.:.:.::..|..|..:|:....|..: |..|.|.|.....|..|:.
  Fly   295 KWHNPD---RQFKCRHSGCERLFISQRHLMCHEATHSGTSSRKSEHCGFCGKTFIHLKTLRWHIY 356

  Fly   373 -VHTGEKPFACEYCDKCYQSVGNLNNHMVRLHADIIEA 409
             .|.||||:.|..|.:.:.|......||:..|.:.:.|
  Fly   357 RQHGGEKPYKCANCTEVFASYAEKRIHMLERHRENLTA 394

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 16/84 (19%)
C2H2 Zn finger 234..255 CDD:275368 7/21 (33%)
C2H2 Zn finger 264..285 CDD:275368 9/21 (43%)
C2H2 Zn finger 293..313 CDD:275368 7/20 (35%)
zf-C2H2_8 305..373 CDD:292531 17/72 (24%)
C2H2 Zn finger 324..344 CDD:275368 4/22 (18%)
C2H2 Zn finger 354..374 CDD:275368 6/21 (29%)
zf-H2C2_2 366..389 CDD:290200 9/24 (38%)
C2H2 Zn finger 382..403 CDD:275368 5/21 (24%)
CG8301NP_649915.1 zf-AD 3..87 CDD:285071 16/85 (19%)
COG5048 198..>508 CDD:227381 59/204 (29%)
C2H2 Zn finger 221..241 CDD:275368 7/20 (35%)
C2H2 Zn finger 249..269 CDD:275368 9/20 (45%)
C2H2 Zn finger 277..297 CDD:275368 7/20 (35%)
C2H2 Zn finger 305..327 CDD:275368 4/22 (18%)
C2H2 Zn finger 338..359 CDD:275368 6/21 (29%)
C2H2 Zn finger 367..384 CDD:275368 4/17 (24%)
C2H2 Zn finger 400..420 CDD:275368
C2H2 Zn finger 451..471 CDD:275368
C2H2 Zn finger 480..500 CDD:275368
C2H2 Zn finger 508..528 CDD:275368
C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 565..582 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86895021
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.