DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30431 and CG10654

Sequence 1:NP_610211.1 Gene:CG30431 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001261767.1 Gene:CG10654 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster

Alignment Length:442 Identity:97/443 (22%)
Similarity:160/443 (36%) Gaps:110/443 (25%)


  Fly    10 LVCRCCLLEQPP--LYHSLYDASSQLAVE---------LKALAPALRLEHGDNLTDVICDLCLRR 63
            ::||.||:...|  ..|:| |:...||.:         ::.|.|.|.|:.       ||:.|.:.
  Fly    38 MICRACLVLLGPQDACHNL-DSEQDLASKYYGCTGEDAVRDLPPQLVLKS-------ICECCYQL 94

  Fly    64 LHDARDFQRRCEHSEQVLRMRHEHWKHTVAVGDALALDDVLECLEREVGSLEGPMSVPLQASKPV 128
            :....||||.|..|                          |...|:                   
  Fly    95 VQKFHDFQRMCAES--------------------------LRNFEK------------------- 114

  Fly   129 AHVAPLMETVDFESLDFQDSSHSEHDIPSYWESSVDSGSLNTPHHQP---ETAELFAVEPP---- 186
                 |::.:|......:|  |:.||:.:..||: :|.:.....|.|   .|.|:.:...|    
  Fly   115 -----LLQDIDIGCHKLED--HTWHDLDTPSESN-ESTNPEAQSHAPCIAATQEIVSFIWPQVCL 171

  Fly   187 ---------TPPESSEEPA---PDAAEKPKMRRARPRQDNVKPKERKASGAVHPRSLHPCPECEK 239
                     |...|.||..   .|.:.|..:.:.:....:.....||..|..|...   |..|.:
  Fly   172 PLAVILSRITLGASLEEEVYVIEDESAKQDLGQEKLSISSKLLGARKRRGVRHTLE---CRICHR 233

  Fly   240 KFTRNFQLKLHMTAVHGMGEMRYQCEECRKNFASRHSLRYHVKSVHSTERP----FGCQHCDRRF 300
            .|.:...|:.||....|:  ..|.|..|.|::|..:.|..|::.:|:....    :.|..|::.:
  Fly   234 GFYKPSLLEAHMQQHEGL--RPYTCVHCAKSYARANLLESHLRQMHNNADAARIIYACPSCNKVY 296

  Fly   301 ILRTQLLSHLRT-----HTGEAKPRIFECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCSKA 360
            .....|..|:|.     |..|:......|:.|.|.:..|:.|..|...|.....|.:.|:.|.:.
  Fly   297 TANRSLKYHMRRTHERYHESESPDARHICEECGKCFARKAHLTRHKMVHGSVEGRRYCCECCDRR 361

  Fly   361 FFTRGHLNSHLLVHTGEKP--FACEYCDKCYQSVGNLNNHMVRLH--ADIIE 408
            |:|:.::..|||...|.|.  ..|..|.:.:|:...||.| .|.|  .|:::
  Fly   362 FYTKENMVDHLLRKHGNKNLLLRCRKCGRIFQNSVELNAH-GRKHKAMDVVQ 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 23/82 (28%)
C2H2 Zn finger 234..255 CDD:275368 6/21 (29%)
C2H2 Zn finger 264..285 CDD:275368 6/21 (29%)
C2H2 Zn finger 293..313 CDD:275368 5/25 (20%)
zf-C2H2_8 305..373 CDD:292531 20/73 (27%)
C2H2 Zn finger 324..344 CDD:275368 6/20 (30%)
C2H2 Zn finger 354..374 CDD:275368 7/20 (35%)
zf-H2C2_2 366..389 CDD:290200 7/25 (28%)
C2H2 Zn finger 382..403 CDD:275368 7/21 (33%)
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 25/134 (19%)
C2H2 Zn finger 228..248 CDD:275368 6/20 (30%)
C2H2 Zn finger 256..313 CDD:275368 12/57 (21%)
C2H2 Zn finger 289..314 CDD:275368 5/25 (20%)
zf-C2H2 323..345 CDD:278523 6/22 (27%)
C2H2 Zn finger 325..345 CDD:275368 6/20 (30%)
C2H2 Zn finger 355..376 CDD:275368 7/21 (33%)
C2H2 Zn finger 385..405 CDD:275368 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24409
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.