DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30431 and D19A

Sequence 1:NP_610211.1 Gene:CG30431 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_477304.1 Gene:D19A FlyBaseID:FBgn0022935 Length:845 Species:Drosophila melanogaster

Alignment Length:503 Identity:123/504 (24%)
Similarity:183/504 (36%) Gaps:141/504 (28%)


  Fly    11 VCRCCLLEQPPLYHSLYDASSQLAV-----ELKALAPALRLEHGDNLTDVICDLCLRRLHDARDF 70
            :||.|      |.|...||:..|.:     :......:|.:|..|.....:|.||..:|::..||
  Fly    12 LCRIC------LNHLQNDAAYDLYLVPGLSKKLCFCTSLSVEQNDGFPKNLCTLCYTKLNELHDF 70

  Fly    71 QRRCEHSEQ-----------VLRMRHEHWKHTVAVGDALA-----------LDDVLECLEREVGS 113
            |::|..|.|           ..:...:.:...|||.|..|           |:..:|.:|.|.  
  Fly    71 QKQCVDSVQKFQDLVASNVFACQSSFDVFDPNVAVQDYPAEEEDHVNYDPLLNHKMELIENEE-- 133

  Fly   114 LEGPMSVPLQASKPVAHVAPLMETVDFES------------------------------LDFQDS 148
                     ...|.:.||....|.|:.|:                              |||:.:
  Fly   134 ---------DVFKMLEHVDKEAEEVEKEAKVEEDDGGNVSVKMFDDDSSIESGNDNDHDLDFEPN 189

  Fly   149 SHSEHDIPSYWE---SSVDSG-------SLNTPHHQPETAELFAVEPPTPPESSEEPAPDAAEKP 203
            | |:.|||....   .:..||       :|:.|..:|. .....::||.|.|  ||.:..::|..
  Fly   190 S-SDDDIPLAQRMRGPATGSGPQQDRFSNLDKPKPRPR-GRPKKIKPPPPEE--EELSDSSSESD 250

  Fly   204 KMRRARPRQDNVKPKERKASGAVHPRSLH---PCPECEKKFTRNFQLKLHMTAVHGMGEMRYQC- 264
            .......|.|  |||.::.  .:..|.||   .|..|.:||.:..:.:.||...:.:  :.:|| 
  Fly   251 DSEDGTSRGD--KPKRKRI--PIEERHLHRIIDCHICHQKFKKAIRYEEHMKYHNDL--LPFQCK 309

  Fly   265 -EECRKNFASRHSLR--------------------------------YHVKSVHSTE------RP 290
             |.|:|.|.:.:.||                                :|:|.||...      |.
  Fly   310 VETCKKGFTTANGLRIHIDHAHTELSEVHACIAEGCGKTFPRVRLLTFHMKKVHGITKAAAPLRD 374

  Fly   291 FGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCD 355
            |.|..||..|...|.|..|:..||||..|  :.|..|.|.:...|.||.|:..|..  .:...|.
  Fly   375 FPCTECDTVFRCPTALKKHMYKHTGEELP--YPCNICGKRFVINSALRDHLMRHAG--IKNHVCP 435

  Fly   356 RCSKAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNHMVRLH 403
            .|.....||...|:|:|.||.||.|.|..||....:...|:||:..:|
  Fly   436 YCGVGKTTRQEWNAHILTHTKEKKFKCRQCDHASHNKQALSNHVKVVH 483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 21/87 (24%)
C2H2 Zn finger 234..255 CDD:275368 6/21 (29%)
C2H2 Zn finger 264..285 CDD:275368 10/55 (18%)
C2H2 Zn finger 293..313 CDD:275368 7/20 (35%)
zf-C2H2_8 305..373 CDD:292531 22/68 (32%)
C2H2 Zn finger 324..344 CDD:275368 7/20 (35%)
C2H2 Zn finger 354..374 CDD:275368 7/20 (35%)
zf-H2C2_2 366..389 CDD:290200 11/23 (48%)
C2H2 Zn finger 382..403 CDD:275368 6/21 (29%)
D19ANP_477304.1 zf-AD 12..83 CDD:214871 21/77 (27%)
C2H2 Zn finger 343..362 CDD:275368 2/19 (11%)
C2H2 Zn finger 377..397 CDD:275368 7/20 (35%)
zf-H2C2_2 389..414 CDD:290200 10/27 (37%)
C2H2 Zn finger 406..426 CDD:275368 7/20 (35%)
C2H2 Zn finger 434..454 CDD:275368 7/20 (35%)
C2H2 Zn finger 462..483 CDD:275368 6/21 (29%)
C2H2 Zn finger 491..511 CDD:275368
C2H2 Zn finger 519..539 CDD:275368
C2H2 Zn finger 652..673 CDD:275368
C2H2 Zn finger 681..701 CDD:275368
zf-H2C2_2 694..718 CDD:290200
C2H2 Zn finger 709..729 CDD:275368
tolA_full 724..>814 CDD:274303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86894831
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.