DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30431 and CG17385

Sequence 1:NP_610211.1 Gene:CG30431 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001286418.1 Gene:CG17385 FlyBaseID:FBgn0033934 Length:278 Species:Drosophila melanogaster

Alignment Length:195 Identity:62/196 (32%)
Similarity:97/196 (49%) Gaps:16/196 (8%)


  Fly   234 CPECEKKFTRNFQLKLHMTAVHGMGEMRYQCEECRKNFASRHSLRYHVKSVHSTERPFGCQHCDR 298
            |..|::.|.......||...||...:..|:|:.|.|:|.:..:|..|:| ||:..|||.|..|.:
  Fly    18 CKRCDRTFRSKRDQTLHRQEVHNHNKTTYECKLCAKSFCNSGNLDRHMK-VHNDVRPFVCNICSK 81

  Fly   299 RFILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCSKAFFT 363
            .|.....|..|...|:||   |.|.|..|:||:..:|:::.|..:|..  |:||:|.||.:.|..
  Fly    82 AFAQAVNLQRHYAVHSGE---RPFTCNFCNKSFTQQSNMKRHKMTHTG--EKPFRCQRCGRYFSQ 141

  Fly   364 RGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNHM---VRLHADI-IEAQLEA------EGIES 418
            ..:|..|.|.|...||:.|.||:|.:..:.|...|:   ::...|: :.|.::|      |.:||
  Fly   142 LVNLKKHKLGHLNAKPYQCNYCEKGFTQLSNFKRHLQSHIKEGVDVDVPASIQAAAALARERLES 206

  Fly   419  418
              Fly   207  206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071
C2H2 Zn finger 234..255 CDD:275368 6/21 (29%)
C2H2 Zn finger 264..285 CDD:275368 8/21 (38%)
C2H2 Zn finger 293..313 CDD:275368 5/20 (25%)
zf-C2H2_8 305..373 CDD:292531 24/68 (35%)
C2H2 Zn finger 324..344 CDD:275368 6/20 (30%)
C2H2 Zn finger 354..374 CDD:275368 7/20 (35%)
zf-H2C2_2 366..389 CDD:290200 10/23 (43%)
C2H2 Zn finger 382..403 CDD:275368 6/24 (25%)
CG17385NP_001286418.1 COG5048 <13..181 CDD:227381 56/169 (33%)
C2H2 Zn finger 18..39 CDD:275368 6/21 (29%)
C2H2 Zn finger 48..68 CDD:275368 8/21 (38%)
C2H2 Zn finger 76..96 CDD:275368 5/20 (25%)
zf-H2C2_2 88..113 CDD:290200 11/28 (39%)
C2H2 Zn finger 104..124 CDD:275368 6/20 (30%)
zf-H2C2_2 116..141 CDD:290200 9/27 (33%)
C2H2 Zn finger 132..148 CDD:275368 5/16 (31%)
zf-C2HE <156..183 CDD:292895 8/27 (30%)
C2H2 Zn finger 160..180 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86894548
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.