DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30431 and Plzf

Sequence 1:NP_610211.1 Gene:CG30431 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001285862.1 Gene:Plzf FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster

Alignment Length:303 Identity:79/304 (26%)
Similarity:107/304 (35%) Gaps:72/304 (24%)


  Fly   153 HDIPSYWESSVDSGSLNTPHHQPETAELFAV-------------------EPPTPPESSEEPAPD 198
            |.|..::...:.|.|.....|..|.|::.||                   |.|.|.|:...|.| 
  Fly    92 HTIVDFFYEDLVSVSKEHELHFRELAQILAVTELLNLYQLQPLGEAKEATEIPAPGEAQPNPDP- 155

  Fly   199 AAEKPKMRRARPRQDNVK---PKERKASGAVHPRSLHPCPECEKKFTRNFQLKLHMTAVHGMGEM 260
              ||........||...|   |:..|:|..|     :.|..|:.|..:..::..||    |..|.
  Fly   156 --EKKAEAVFENRQSYFKLKNPRAVKSSSKV-----NYCIGCDFKCYQVQKMIEHM----GSCEP 209

  Fly   261 RYQ-CEECRKNFASRHSLRYHVKSVHSTE--RPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRIF 322
            .:. |..|...|........|::. ||.:  :||.|..|..||..|..||.|...|:.|. |.| 
  Fly   210 SHLICSLCEVGFLDWREYDTHLRR-HSGDLRKPFFCLQCGIRFNTRAALLVHQPKHSTET-PHI- 271

  Fly   323 ECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGE---------- 377
             |..|.|.:..|..|..|:..|||  |:...||.|..:......|.||.|:||||          
  Fly   272 -CPHCGKGFKWKQGLSNHILVHNP--EKQMLCDVCGYSTTHMKALKSHKLLHTGEFFACTVSGCK 333

  Fly   378 -------------------KPFACEYCDKCYQSVGNLNNHMVR 401
                               :.|.||.|...:....||..|.::
  Fly   334 HRANRKENLKLHIETHKQGRDFICEVCGCKFSQSKNLKRHALK 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071
C2H2 Zn finger 234..255 CDD:275368 5/21 (24%)
C2H2 Zn finger 264..285 CDD:275368 4/21 (19%)
C2H2 Zn finger 293..313 CDD:275368 8/20 (40%)
zf-C2H2_8 305..373 CDD:292531 24/68 (35%)
C2H2 Zn finger 324..344 CDD:275368 6/20 (30%)
C2H2 Zn finger 354..374 CDD:275368 7/20 (35%)
zf-H2C2_2 366..389 CDD:290200 12/52 (23%)
C2H2 Zn finger 382..403 CDD:275368 6/21 (29%)
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 53/195 (27%)
C2H2 Zn finger 214..234 CDD:275368 4/21 (19%)
C2H2 Zn finger 244..264 CDD:275368 8/20 (40%)
C2H2 Zn finger 272..292 CDD:275368 6/20 (30%)
C2H2 Zn finger 300..320 CDD:275368 7/20 (35%)
C2H2 Zn finger 330..349 CDD:275368 0/19 (0%)
C2H2 Zn finger 357..377 CDD:275368 6/21 (29%)
C2H2 Zn finger 387..408 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C264129772
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24409
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.