DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30431 and CG3847

Sequence 1:NP_610211.1 Gene:CG30431 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_572317.2 Gene:CG3847 FlyBaseID:FBgn0029867 Length:380 Species:Drosophila melanogaster

Alignment Length:329 Identity:71/330 (22%)
Similarity:119/330 (36%) Gaps:74/330 (22%)


  Fly    95 GDALALDDVLECLEREVGSLEGPMSVPLQASKPVAHVAPLM--ETVDFESLDFQDSSHSEHDIPS 157
            |.|:.|.:::|....|..::|..     ..:..:.|:.|.:  |.|: |..:.:|....|||   
  Fly    88 GHAVTLQELVENSTVEEETIEQG-----DGTHTILHIVPNIHGEEVE-EDEELEDGEEVEHD--- 143

  Fly   158 YWESSVDSGSLNTPHHQPETAELFAVEPPTPPESSEEPAPDAAEKPKMRRARPRQDNVKPKERKA 222
                    ....|..|  |..|| .||.........|...|.||:....|               
  Fly   144 --------DEFVTVDH--EGGEL-EVEDDEVGSIVFESTIDHAEQDPYGR--------------- 182

  Fly   223 SGAVHPRSLHPCPECEKKFTRNFQLKLHMTAV----HGMGEMRYQCEECRKNFASRHSLRYHVKS 283
                  .....||.|...::....|||||.|.    :.:.....:|:.|.|.|.|...|:.|:..
  Fly   183 ------NKTFYCPNCGNCYSAAGSLKLHMRACLRQRNEISTDERKCKVCSKVFNSVAYLKEHMMR 241

  Fly   284 VHSTERPFGCQHCDRRFILRTQLLSHLRTHTGEAK------------------PRIFECQRCSKS 330
             |:.|:||.|..|.|:|:..::..:|:.:|..:.|                  .:.|:|..||::
  Fly   242 -HTGEQPFRCTRCYRKFVEESKFTAHMESHKHQDKLEAEAVALAAQHGGKKVVVKEFQCAFCSQN 305

  Fly   331 WPTKSDLRTHMRSHNPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNL 395
            :....|:        ..::|.:.||.|...:.....|..|......::.|:|..|.:.:...|.|
  Fly   306 FTVVFDV--------GQVKRRYACDACRDKYSNAEALRQHKQQVEEKREFSCVRCGRKFVFEGFL 362

  Fly   396 NNHM 399
            ..|:
  Fly   363 QRHL 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071
C2H2 Zn finger 234..255 CDD:275368 9/25 (36%)
C2H2 Zn finger 264..285 CDD:275368 7/21 (33%)
C2H2 Zn finger 293..313 CDD:275368 5/20 (25%)
zf-C2H2_8 305..373 CDD:292531 14/86 (16%)
C2H2 Zn finger 324..344 CDD:275368 4/20 (20%)
C2H2 Zn finger 354..374 CDD:275368 5/20 (25%)
zf-H2C2_2 366..389 CDD:290200 5/23 (22%)
C2H2 Zn finger 382..403 CDD:275368 5/19 (26%)
CG3847NP_572317.2 C2H2 Zn finger 188..216 CDD:275368 9/28 (32%)
C2H2 Zn finger 222..242 CDD:275368 7/21 (33%)
C2H2 Zn finger 250..270 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24409
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.