powered by:
                   
 
    
    
             
          
            Protein Alignment CG30431 and CG11398
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_610211.1 | Gene: | CG30431 / 35549 | FlyBaseID: | FBgn0050431 | Length: | 418 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_001259122.2 | Gene: | CG11398 / 31070 | FlyBaseID: | FBgn0040366 | Length: | 329 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 186 | Identity: | 54/186 - (29%) | 
          
            | Similarity: | 76/186 -  (40%) | Gaps: | 10/186 - (5%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly   216 KPKERKASGAVHPRSLHPCPECEKKFTRNFQLKLHMTAVHGMGEMRYQCEECRKNFASRHSLRYH 280:|..|...|...|.|.|.|..|.:.|.::..|..||.|.:.:  ..|.|.||...|..|.:...|
 Fly    69 RPTHRYQGGQQTPASEHACDACGRVFQKHNALVDHMNAHNDV--RNYPCPECPARFVQRSNRECH 131
 
 
  Fly   281 VKSVHSTERPFGCQH--CDRRFILRTQLLSHLRT-HTGEAKPRIFECQRCSKSWPTKSDLRTHMR 342:|:||.......|..  |.:||..|.:...|::| |..|   |...|..||..:....:.|.|:.
 Fly   132 LKNVHRKVYLHSCPEPGCKKRFQQRRECDQHVKTVHQNE---RNLVCDTCSARFSHPVNYRKHLA 193
 
 
  Fly   343 SHNPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNH 398||  ...:.:.|..|.|.|....:.:.||.||:..|.:.|..|...|.....|..|
 Fly   194 SH--GSAKSYGCPICGKLFGRPENRDVHLFVHSICKAYICSVCGADYMRRNQLIRH 247
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 1 | 0.930 | - | - |  | C45446602 | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | P | PTHR24409 | 
          
            | Phylome | 0 | 0.000 | Not matched by this tool. | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 2 | 2.030 |  | 
        
      
           
             Return to query results.
             Submit another query.