DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30431 and ces-1

Sequence 1:NP_610211.1 Gene:CG30431 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_492338.1 Gene:ces-1 WormBaseID:WBGene00000468 Length:270 Species:Caenorhabditis elegans

Alignment Length:284 Identity:68/285 (24%)
Similarity:114/285 (40%) Gaps:54/285 (19%)


  Fly   133 PLMETVDFE-------SLDFQDSSHSEHDIPSYWESSVDSGSLNTPHHQPETAELFAVE------ 184
            |::...||:       ||..|....|.....|...||..|.:|.......:...:|:::      
 Worm    20 PIIGNCDFQAQLWHLMSLHLQMQKSSAASTSSSSSSSTSSENLKKSPSSVQNTSVFSIDNILNSQ 84

  Fly   185 --PPTPPESSEEPAPDAAEKPKMRRARPRQDNVKPKERKASGAVHPRSLHPCPECEKKFTRNFQL 247
              |....|:.|:.:  ::..|.........|:::..:|::.....|.|.:.|             
 Worm    85 KVPKLELENDEDVS--SSPSPTCSTTGYTLDSLQNLDRRSLNKKGPSSHNRC------------- 134

  Fly   248 KLHMTAVHGMGEMRYQCEECRKNFASRHSLRYHVKSVHSTERPFG--CQHCDRRFILRTQLLSHL 310
                           .|::|.|::|:..:|..|.::..:.:.|..  |.||||.::....|..|:
 Worm   135 ---------------VCDKCGKSYATTSNLSRHKQTHRALDSPHAKQCPHCDRVYVSMPALSMHI 184

  Fly   311 RTHTGEAKPRIFECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCSKAFFTRGHLNSHLLVHT 375
            .||...     .||..|.|.:.....|:.|:|||..  .|||.|..|.|:|..|.:|.:|:|.||
 Worm   185 LTHNAS-----HECNVCGKRFSRLWLLQGHLRSHTG--LRPFSCAHCGKSFADRSNLRAHMLTHT 242

  Fly   376 GEKPFACEYCDKCYQSVGNLNNHM 399
            |:|.|.|:.|.:.:.....||.|:
 Worm   243 GDKRFECDKCGRRFALRAYLNRHL 266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071
C2H2 Zn finger 234..255 CDD:275368 1/21 (5%)
C2H2 Zn finger 264..285 CDD:275368 6/21 (29%)
C2H2 Zn finger 293..313 CDD:275368 8/20 (40%)
zf-C2H2_8 305..373 CDD:292531 24/68 (35%)
C2H2 Zn finger 324..344 CDD:275368 7/20 (35%)
C2H2 Zn finger 354..374 CDD:275368 8/20 (40%)
zf-H2C2_2 366..389 CDD:290200 10/23 (43%)
C2H2 Zn finger 382..403 CDD:275368 5/19 (26%)
ces-1NP_492338.1 C2H2 Zn finger 167..187 CDD:275368 8/20 (40%)
C2H2 Zn finger 193..213 CDD:275368 7/20 (35%)
zf-H2C2_2 206..229 CDD:290200 12/25 (48%)
zf-C2H2 219..241 CDD:278523 9/22 (41%)
C2H2 Zn finger 221..241 CDD:275368 8/20 (40%)
zf-H2C2_2 233..257 CDD:290200 10/24 (42%)
C2H2 Zn finger 249..268 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.