| Sequence 1: | NP_610211.1 | Gene: | CG30431 / 35549 | FlyBaseID: | FBgn0050431 | Length: | 418 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_509284.2 | Gene: | unc-98 / 181020 | WormBaseID: | WBGene00006827 | Length: | 310 | Species: | Caenorhabditis elegans |
| Alignment Length: | 282 | Identity: | 69/282 - (24%) |
|---|---|---|---|
| Similarity: | 108/282 - (38%) | Gaps: | 46/282 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 136 ETVDFESL----DFQDSSHSEHDIPSYWESSVDSGSLNTPHHQPETAELFAVEPPT--------- 187
Fly 188 --PPESSEEPAPDAAEKPKMRRARPRQDNVKPKERKASGAVHPRSLHPCPECEKKFTRNFQLKLH 250
Fly 251 MTAVHGMGEMRYQCEECRKNFASRHSLRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTHTG 315
Fly 316 EAKPRIFECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCSKAFFTRGHLNSH-LLVHTG--E 377
Fly 378 KPFACEYCDKCYQSVGNLNNHM 399 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG30431 | NP_610211.1 | zf-AD | 11..82 | CDD:285071 | |
| C2H2 Zn finger | 234..255 | CDD:275368 | 5/20 (25%) | ||
| C2H2 Zn finger | 264..285 | CDD:275368 | 6/20 (30%) | ||
| C2H2 Zn finger | 293..313 | CDD:275368 | 7/19 (37%) | ||
| zf-C2H2_8 | 305..373 | CDD:292531 | 15/68 (22%) | ||
| C2H2 Zn finger | 324..344 | CDD:275368 | 1/19 (5%) | ||
| C2H2 Zn finger | 354..374 | CDD:275368 | 7/20 (35%) | ||
| zf-H2C2_2 | 366..389 | CDD:290200 | 10/25 (40%) | ||
| C2H2 Zn finger | 382..403 | CDD:275368 | 9/18 (50%) | ||
| unc-98 | NP_509284.2 | C2H2 Zn finger | 115..135 | CDD:275368 | 5/20 (25%) |
| C2H2 Zn finger | 143..163 | CDD:275368 | 6/20 (30%) | ||
| SFP1 | <169..268 | CDD:227516 | 32/112 (29%) | ||
| C2H2 Zn finger | 171..189 | CDD:275368 | 7/20 (35%) | ||
| C2H2 Zn finger | 248..268 | CDD:275368 | 9/18 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24409 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||